CAZyme Information: ASPVEDRAFT_164665-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_164665-t33_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	KV878127|CGC12	73329.83	4.2117

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878127:1558587-1560674(-)

Full Sequence      

MSVTTSTAPAATGTLAANILILARDSTQADVASSGLNGYGIPYTTLLVPQAGVELPALNS
SSGGNFGGIVVAGEVSYDYGSDSWRSALTDDQWNQLYAYQLAYGVRMVQYDVFPGPKFGA
SSVGDGGCCADGVEQLVYFSDTDDFPTAGLRTGSNAGVSTEGLWHYPASVSDTNTTKAIA
SFAAGGGVSGESAAAVINNFDGRQQMVFFIGFDTVWSQTSNYLQHAWITWVTRGLYAGHR
RVNLNTQIDDMFLETDIYSPAGRIYRIGTADMDGITSWLPTIRGKLNAGSTYFVEIGHNG
NGNIEAAVEAAGENTCSGGAIEYDSPPDTELEFQKPLGSGTSLWPSSPANYTWTTTCTNS
DSLLIWFQEHLNDYAYISHTFTHLEQNNATYEDIYKEISFNQAWLRQVGFANAQWFTSNG
IIPPAITGLHNGDALRAWADNGITNCVGDNTRPALLNTENAMWPYFTKVSTDGFDGIQVN
PRWATRIYYNCDTPECTTQEWIDTSAGAGTFTDLLATERAETLRHFFGLHRDPFMFHQAN
LRNTGIDPITVNGETAQISIFQAWVETVVAEFTRLVNWPVVTTTHQEMSDYFLQRYRRDQ
CGYSLSYVLDDNRITGVTLSANGNSCDAAIPVTFPDAPSDTHGFSTEQLGSDPVTVWAQL
SGSPVTFSLASPIAL

Enzyme Prediction     

EC	3.5.1.-:2	3.5.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE18	242	606	4.9e-190	0.997275204359673
CBM87	22	241	2.9e-111	0.9954128440366973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396211	Polysacc_deac_1	6.55e-04	378	444	63	122	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22373.1|CBM87|CE18	0.0	9	675	128	794
EAA63525.1|CBM87|CE18	0.0	1	675	237	912
UCK57933.1|CBM87|CE18	0.0	11	675	132	794
BAE56403.1|CBM87|CE18	0.0	2	675	14	685
QMW25504.1|CBM87|CE18	0.0	24	675	145	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NWZ_A	0.0	13	675	21	684	Crystal structure of Agd3 a novel carbohydrate deacetylase [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

ASPVEDRAFT_164665-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.941722	0.058294

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_164665-t33_1-p1.