CAZyme Information: ASPVEDRAFT_161006-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_161006-t33_1-p1
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	KV878126|CGC5	48276.01	7.5681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:718369-719808(-)

Full Sequence      

MLLPRHCRRLAIFAIVLATLVCWNSLRHTHGTAVINSQDQYPLLTKYIRGSRVQGGALRL
PKEWSKGITSPIDSILAAAELVRNKTSSDPQGHIPNSNIPRIIHQTWKDKNIDAWPQTYR
ESAEKWMQVVEEKDIPYLFWDDVGVAQFMRYFEPDFEAEFYSLPSNVERSDVFRILVCKW
IGGVYADMDTAPIRPPTEWISQIDLQPWTDHKTQKKYQSSKPVTAVVGIEADNDPERDIY
WRMGYFFPVQLTQWSFAFAPHHPILQIFIDRLRATIRLYARDVNNQQPLPDSHPGVLDYV
DPVNLTGPIAFTDAVRTYLEMEGDLRWDAVTGLQDGPDGGVSKLVEDVLVLPITGFSPGS
RRFRDMGSKPVTHHAARLYHHAQGSWRKWNLRVEMGKFCRTAFGLCRDWSKVSHGDSWIF

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_161006-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.92e-16	99	275	82	246	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.21e-09	124	202	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21129.1|GT32	3.76e-242	1	360	1	362
EAA62973.1|GT32	6.96e-203	1	420	1	416
EAA64740.1|GT32	1.91e-181	16	384	1	365
QMW48355.1|GT32	1.89e-149	3	414	3	412
QMW36299.1|GT32	2.68e-149	3	414	3	412

PDB Hits     

ASPVEDRAFT_161006-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.25e-23	96	387	139	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.01e-21	99	387	99	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.11e-16	99	388	96	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	9.82e-14	99	379	130	387	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|O14084|IMT1_SCHPO	2.16e-10	81	202	46	165	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.831562	0.168458

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_161006-t33_1-p1.