CAZyme Information: ASPVEDRAFT_156456-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_156456-t33_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		56475.24	5.2062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878141:286921-288570(-)

Full Sequence      

MAPAALPQSADYVIVGGGTSGLVLASRLSEDPNVNIVVLESGPDRTTDPEVRDPLVWRAL
SGSDLDWKPRTTPQGGLNNRTLDHPAGRVLGGSSTINGLVLTSPSPAGMDAWAKLGNPDW
TWETFKPYLQKSYTVPGKAVEGVIKTMEPTLVDGVDNTLVQAWIDAHAEEGYLKATDFEG
EERTIGVRPFTATIDPATGTRSSADNTYGAVASACPNVTIVTGATVKRILFSEGITASGV
KVDYKGSSVTVGAVKEVILAAGAFHTPKLLELSGVGDTERLKSLGIPPVLHSSGVGENLQ
NHTMGVIPVPLKDNPDLADVKPGIQALAFRQLDPNDITEVLKQKQEWNGDEEVIKSLLQS
PNEASAYSLIGMMQNLAIVVVMLTFPFSRGSVHIRSADPGAPPIIDPRLLSNDLDIEFLA
RHVQALRRLLSSPAFQPLLQSPREPSELAKLKTTLRESMASTAHHACGTAAMLPKEHGGV
VDQDLKVYGTTNLRIVDASIFPLIPHANPMATVYGVAERAADLIKGAIGDN

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_156456-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	525	1.3e-150	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.14e-101	8	526	4	533	choline dehydrogenase; Validated
225186	BetA	1.56e-92	3	529	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.69e-37	386	520	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.14e-26	75	303	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.43e-24	11	513	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25452.1|AA3_2	1.08e-317	1	526	1	527
QRD83786.1|AA3_2	1.46e-155	8	525	2	530
QMW32332.1|AA3_2	1.46e-155	8	525	2	530
QMW44362.1|AA3_2	4.72e-154	8	525	2	530
UDD57301.1|AA3_2	4.72e-154	8	525	2	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.03e-59	11	525	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	5.91e-57	12	525	8	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.70e-53	11	525	3	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.34e-52	11	525	4	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	1.55e-48	8	527	15	590	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2H3D1U1|ARMD5_ARMGA	1.17e-68	9	525	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	3.29e-65	8	526	45	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.29e-65	8	526	45	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A142PTM2|CITC_MONPU	9.57e-58	11	525	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	9.57e-58	11	525	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000005

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_156456-t33_1-p1.