CAZyme Information: ASPVEDRAFT_147337-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_147337-t33_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		39702.51	8.4101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:884508-885662(+)

Full Sequence      

MASAARSASRALLRSSFRPAVRSTRSALPQGFRAGSRRGYSSEAEPPKSSSNTLLWAGLA
AAGGAGAYFYLKGADSGINSANFTPTQADYQKVYDAIAERIANETDYDDGSYGPVLVRLA
WHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKHARDFLEPIKAKFPWITYSDLWTL
AGSCAVQELGGPAIPWRPGRQDKDVAACTPDGRLPDAAKDHVHIRDVFGRMGFDDREMVA
LLGAHALGRAHTDRSGFDGPWNFSPTVFTNEFFRMLVDEKWENRKWNGPAQFTDKTTKTL
MMLPTDIAIIKDKGFKKHVDRYAKDSDVFFKEFADVYVKLLELGVPFTSKPEDRFVFKSS
E

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_147337-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	93	345	1.3e-62	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	1.47e-141	86	347	9	252	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	4.90e-83	114	344	32	243	L-ascorbate peroxidase
166005	PLN02364	4.20e-65	80	344	2	246	L-ascorbate peroxidase 1
223453	KatG	1.87e-64	89	358	69	430	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
178467	PLN02879	5.03e-64	113	344	34	246	L-ascorbate peroxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21067.1|AA2	2.72e-259	1	361	1	361
QRD85779.1|AA2	3.68e-223	1	361	1	362
QMW29426.1|AA2	3.68e-223	1	361	1	362
QMW41498.1|AA2	3.68e-223	1	361	1	362
UDD58631.1|AA2	3.68e-223	1	361	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	3.70e-87	89	361	18	290	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	3.95e-87	89	361	20	292	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	5.59e-87	89	361	20	292	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	1.35e-86	89	361	15	287	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	1.48e-86	89	361	18	290	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C0V3|CCPR_EMENI	1.55e-224	1	361	1	361	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4WPF8|CCPR_ASPFU	4.18e-221	1	361	1	366	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	4.23e-163	18	358	10	353	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	6.58e-160	4	359	3	355	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	1.82e-153	6	358	10	358	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999686	0.000320

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_147337-t33_1-p1.