CAZyme Information: ASPVEDRAFT_145097-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_145097-t33_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	KV878141|CGC4	23037.67	4.1440

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878141:380518-381215(+)

Full Sequence      

MVSFSTLLVACSAAAGAFAAPSDKSLAQRSTESSTGTNNGYYYSFWTDGGGDVTYTNGDG
GSYNVGWTDVGNFVGGKGWNPGSTSRTINFEGTFSPNGNGYLSVYGWTQNPLIEYYVVES
YGDYNPGTAGEHQGTVESDGGTYDIYTATRENAPSIDGTATFTQFWSVRQDKRSSGSVTI
GNHFDAWTGLGMTLGTHNYQIVAVEGYQSSGSASITVS

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	39	216	5.4e-76	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	2.57e-102	39	214	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25521.1|GH11	5.68e-146	1	218	1	217
EAA66432.1|GH11|3.2.1.8	3.65e-127	1	218	1	221
CAA90074.1|GH11|3.2.1.8	2.11e-126	1	218	1	221
BCS20460.1|GH11	1.86e-116	1	217	1	223
CAA90073.1|GH11|3.2.1.8	7.84e-116	1	217	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JRM_A	2.94e-86	31	218	7	193	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
4XQD_A	3.53e-86	35	218	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
1TE1_B	3.65e-86	28	218	1	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
2JIC_A	3.65e-86	35	218	7	190	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]
5K7P_A	3.65e-86	35	218	7	190	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P55333|XYNB_EMENI	6.48e-128	1	218	1	221	Endo-1,4-beta-xylanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnB PE=2 SV=2
sp|P55332|XYNA_EMENI	1.39e-116	1	217	1	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1
sp|Q9HFA4|XYNA_ASPOR	4.18e-108	1	217	1	231	Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnA PE=1 SV=1
sp|B8NKE9|XYNA_ASPFN	4.18e-108	1	217	1	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnA PE=3 SV=2
sp|Q4WG11|XYNA_ASPFU	7.35e-108	1	217	1	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000358	0.999622	CS pos: 29-30. Pr: 0.6550

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_145097-t33_1-p1.