CAZyme Information: ASPVEDRAFT_144288-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_144288-t33_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	KV878140|CGC1	68184.22	6.8470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878140:242050-244005(+)

Full Sequence      

MGRNPHTDPQRYATPQQLVGPPATYASAQRGLLNYDYVIVGAGAAGCVLANKLSADKNVS
VLLLEAGSDNTKIFESKVPLLFSKLFHTQNDWEYYTVEQPELANRRLYWPRGKVLGGSSS
LNAMMYHHCASSDFDEWASVHGCKGWSYDDLAPHFRTMEKFTHNPNRPSINRQHRGRLGQ
WQTGYTWLSEIVEKGFLPACEEADIPPNPDINTREGTMGVTRFQTFIDPKGQRASLATAF
LTPEVLARPNLYVACNAYVTRVLFDQITNRKEPRAIGVEFQMARGGERFQVHARREVVLS
GGTINTPQTLLLSGIGPEDELKAHGIPVVQANDAVGRNMKDHLCTTPIIAKAKRSATLDY
LGDTLYALPALARWMLTGGGPLTSNVGEAAAFIRTTEYNFPQTVNPPKDNASGPASPDIE
IIGAPLAFIHHGEERPSDGSSVFTLVPIGLRPKSSGTITLKTRDVFDAPIIDPKYLSDEG
NNDRNVLLVGLRVCIKIIHSAAFQKYFEAVPVDDDPTSYWWPYSSSNPDNISDEQLLRFM
DEKAFTLYHPVGTARMGPSAENSVVDTECRVHGVRGLRVMDASVFPEQISGHPTAPIAAM
AAKLGEMINAGRGPAPVTARL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_144288-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	609	2e-169	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.34e-142	35	616	6	538	choline dehydrogenase; Validated
225186	BetA	1.24e-127	33	617	6	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	5.02e-57	36	608	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.95e-46	452	604	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.20e-42	104	344	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23466.1|AA3_2	0.0	1	621	1	620
QMW32344.1|AA3_2	0.0	3	609	6	615
QRD83803.1|AA3_2	0.0	3	609	6	615
QMW44376.1|AA3_2	0.0	3	609	6	615
UDD57318.1|AA3_2	0.0	3	609	6	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	3.48e-83	35	609	8	561	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	6.83e-83	35	609	8	561	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	6.83e-83	35	609	8	561	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	6.83e-83	35	609	8	561	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.01e-82	35	609	24	577	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A3B1EFP9|STR4_STRTC	6.98e-137	7	609	9	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1
sp|P64264|Y1310_MYCBO	5.53e-100	36	609	6	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	5.53e-100	36	609	6	527	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	5.53e-100	36	609	6	527	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	9.82e-84	34	608	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999899	0.000139

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_144288-t33_1-p1.