CAZyme Information: ASPVEDRAFT_141582-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_141582-t33_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	KV878136|CGC5	26127.88	3.7062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878136:699971-700778(+)

Full Sequence      

MPVFSKLLVLPLLATTALAAPKLAKRFTFPIPGSTGSVTFDEPYEIAAGETYDGELQTFG
RGVECTGQDEGGESDTVFIVQEGGTLRNAIIGADQIEGVYCLGACTIENVWWEKVCEDAL
SLKEGSGPYNVIGGGAQGAEDKVIQHNSEGEVIIDGFTVYDFGKLYRSCGTCGDVQRTAT
ISNVIAVEGSTIAGANGNFGDVVTIDSSNCATDVGAICTTYEADADGGEPEETSTDPTEA
CVFEELPACE

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	34	222	2.3e-72	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.76e-100	28	222	1	194	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28578.1|PL3_2	1.13e-166	1	250	1	251
EAA58566.1|PL3_2	9.05e-163	1	250	1	257
QMW26393.1|PL3_2	1.28e-110	6	249	4	242
BAE55530.1|PL3_2	1.28e-110	6	249	4	242
QMW38472.1|PL3_2	1.28e-110	6	249	4	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.61e-25	42	212	7	179	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.96e-20	36	170	6	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	2.01e-20	36	170	7	139	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	1.75e-19	36	170	15	147	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	1.75e-19	36	170	15	147	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AY82|PLYG_EMENI	1.61e-163	1	250	1	257	Probable pectate lyase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyG PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	1.28e-123	6	245	4	241	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	4.60e-118	4	249	2	242	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	4.60e-118	4	249	2	242	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	2.82e-114	4	249	2	241	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999698	CS pos: 26-27. Pr: 0.9473

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_141582-t33_1-p1.