CAZyme Information: ASPVEDRAFT_140724-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_140724-t33_1-p1
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34077.67	5.1728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878135:685274-686342(-)

Full Sequence      

MRIRRPLSPSTSTILTLLTFLTTVLCSPHSSPANTPRASKPFLLRILPLGASITVGYQSS
DGNGYRKFLREQLRFAGWEVDMVGSLANGTMKDNQNEGHFGKTIDQVANAAVDSAPLQPN
VILINVGTNDGIQNVHITGAGERIDTLIDDLLARIPNTTIILSTLIPNTQIQRVVERLSG
EYRSVAARRRAQGDRVILAEMSYFVSSNKLVDGTHPDDEGYKEMAAVWWDAIKTAEEEGM
LARPNKMAVTAVAAVQDGNGTGEGNEGKGLDDGPVEDPKLPYYIAPPQPGETSSSTALGV
GYLWLLLVVGFLYIN

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_140724-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	44	232	9.5e-66	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.91e-49	44	232	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	8.31e-17	46	231	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.99e-15	49	222	2	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	1.10e-10	45	228	3	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	1.30e-08	45	239	10	215	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30471.1|CE3	4.66e-181	1	307	1	325
EAA61410.1|CE3	8.81e-106	14	301	82	432
CAP86338.1|CE3	3.04e-80	36	311	45	311
BAE62547.1|CE3	6.13e-73	32	244	44	258
UDD56943.1|CE0	1.38e-67	32	267	44	281

PDB Hits     

ASPVEDRAFT_140724-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPVEDRAFT_140724-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001510	0.998456	CS pos: 26-27. Pr: 0.9778

TMHMM  Annotations     

Start	End
292	314