CAZyme Information: ASPVEDRAFT_139940-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_139940-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	KV878134|CGC12	62743.30	4.1227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878134:588412-590423(+)

Full Sequence      

MQRLLSIAGLSALLLVAHAQNSSTCSGTFTPITAKEFVANLHPGWNLGNTLDAIPDEGSW
NNAPVEEATLDLIKESGFKSVRLPVTWTHHFTSNSSDWTVDPEWLQRVSDVLDFITARDL
YAIVNVHHDSWEWADVTAAGANITLIEEKFYRLWYQIGTTLGCKSSLVAFESINEPPAET
AEHGAEINKLNSIFLQAIADAGGFNSQRVVNLVGGGQDSVKTSQWFEAPANITNPWAIQF
HYYSPYDFIFSAWGKTIWGSDSTKDTLTTEFELIRNNFTDVPLILGEYDASVTNTEPAAR
WKYFDHLQKVAAQFDIATVLWDNGEDQLDRTTGEWRDPTTLDLVIGTTAETTNSLPDSTE
DATASEQSSSAYIFHRAGTQVTNQALPYIFNGNSLESITDSAGTVLESGSDYSVSGDNIV
FSASYLGTKYTASTAPGVIDTLTLEFDGGVASPRIEIVQWDTPVLASKSASASAVAGSDY
SIPITWKGLSKPATVKALTNSGVYLFDDWTQYLGPLEQARTTYSSQWNWDDENVILTSAA
IDAVVAAGETSVFTFEFYPRVNGTLNTANFTLTV

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	57	324	8.2e-65	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.34e-28	57	324	16	269	Cellulase (glycosyl hydrolase family 5).
397483	CBM_X2	1.48e-18	367	457	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
225344	BglC	3.09e-15	36	324	46	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25048.1|GH5_4	0.0	1	574	1	574
EAA59690.1|GH5_4	0.0	1	574	1	572
CAP96338.1|GH5_4	7.44e-286	1	574	1	574
QQK43655.1|GH5_4	1.44e-285	25	574	44	592
QMW40745.1|GH5_4	7.48e-280	5	574	4	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	2.23e-86	32	560	22	524	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	8.84e-53	35	544	11	505	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	2.05e-52	35	544	44	538	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
5E09_A	1.64e-51	35	544	11	505	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
4V2X_A	1.03e-48	6	512	29	527	Chain A, Endo-beta-1,4-glucanase (cellulase B) [Halalkalibacterium halodurans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	1.51e-52	31	573	34	562	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|P28623|GUND_CLOC7	8.20e-41	6	324	16	339	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
sp|P10477|CELE_ACET2	1.11e-39	32	324	55	352	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
sp|P28621|GUNB_CLOC7	3.17e-37	22	324	30	341	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
sp|P54937|GUNA_CLOLO	8.89e-36	33	323	38	344	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999717	CS pos: 19-20. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_139940-t33_1-p1.