CAZyme Information: ASPVEDRAFT_139465-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_139465-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	KV878134|CGC8	40340.37	7.2875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878134:730923-732014(-)

Full Sequence      

MHHIGQKILNKLGNHAGHGPGPPPSEGPPLQGQRRINEDERLLGSHPRGTYPRLAKLSDG
SILSGFTRFEGRTRVLQIARSTDGGYRFDDFSEVSRGDGDVDNMYLLEVAPMTVLAAFRN
HDLGPHGPTHFRITVCQSTDGGKHWRFLSQAAEKRPPLGIWEPFMRMSHRGEVMLTYSQE
FAHNNQCTMLVRSNDGGATWSPPQCLEGEKDPFRDGMNGIAKTWDNGREALVMVFETTTF
GPFDLEALISYDDGHTWGNRHRVYVPRRGHNAGSPQVASFGDGSLAVIFMNDEDHHQVQW
TKNAAIKVVYGSPPSNGKIQWSRPEVICPHLSHWPGIMAMDDKTLLATYECGGAPKAKSI
TLH

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_139465-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	47	309	9e-71	0.9153094462540716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.51e-10	109	362	21	335	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	2.40e-04	121	261	130	255	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
404074	BNR_2	8.66e-04	188	327	82	204	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24955.1|GH93	1.70e-259	1	363	1	365
EAA62412.1|GH93	3.08e-219	3	363	4	367
QMW42642.1|GH93	5.40e-188	4	363	5	379
QMW30589.1|GH93	5.40e-188	4	363	5	379
QRD89469.1|GH93	5.40e-188	4	363	5	379

PDB Hits     

ASPVEDRAFT_139465-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPVEDRAFT_139465-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_139465-t33_1-p1.