CAZyme Information: ASPVEDRAFT_138896-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_138896-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		35982.55	7.5276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878133:519492-520463(+)

Full Sequence      

MVSFSGKATRKLIVAVALSLIVIVVHHLSYADESVLAGELSESVNIINGCSRAALNPIDT
LTPAIDPGIPNTIHQIWKTANVEDYSTEIKPSHHAWKTMFEPLNYTVKLWTDDDILNLVK
DKYPWLLQTYLGYPHNIQRADIARLLIVHTEGGTYADLDVYPSSAEHIQCLQRLGMQSVF
APTGGTSGLSNHFFMAERASPLLEWALYEAKRRGRGLALQRIVLPYLLVFWSTGPIMLTA
AVRKYAWLYDTIPGNIALLDEGYSGAVIRHVAGRSWQGVDGQALNYIADHAGTEVLLRII
AYLFVIVGLVCVIRRYYGRCSTR

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_138896-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	95	163	2.9e-16	0.7888888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.29e-17	64	245	77	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.01e-10	104	181	17	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98326.1|GT32	3.87e-128	1	319	1	318
UNI15388.1|GT32	1.50e-122	31	317	12	304
BCS10670.1|GT32	5.06e-119	44	319	13	288
CAP80286.1|GT32	9.52e-113	5	290	58	344
UQC87643.1|GT32	2.49e-107	1	293	1	297

PDB Hits     

ASPVEDRAFT_138896-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT67|IMT2_SCHPO	1.93e-17	66	290	79	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.36e-16	69	306	57	284	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	3.42e-15	55	308	44	283	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.00e-13	69	308	62	291	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.014401	0.985575	CS pos: 31-32. Pr: 0.9592

TMHMM  Annotations     

Start	End
222	241
295	317