CAZyme Information: ASPVEDRAFT_138827-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_138827-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		66593.72	6.0942

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878133:639811-641725(-)

Full Sequence      

MAAIDTDSVAGVHDSSFDFIIIGGGTSGLVVANRLSEDPNVSVLVLEAGTNRLNDPRITI
PGLAPTTFEDPDFDWNFRSTPQEQLNGRKILGNKGRTLGGSSTINLGMVVYPSRTGMAAW
EALGNPGWGWEGFEQYVRKFHTGTPPTKSVRSFFEGMKSEKEDQGASGPVQVSFGDQYMP
YHGAWLRAFENLGWPQTEDPIKGAGVGPFVTPGAIDPVTHTRSHAAAAYLTGDVTKRANL
RIVTGALVEKIVFNDSDTGAEDAITARGIRFAKDGQVYRVSASREVILAAGAIQTPQLLE
LSGIGNASLLHSHGIRPLVDLAGVGENLQDHGIVSFGYEVADGMPSGDMARDPAVAAAAM
AAYQKDGSGPLGMVPLVSAFMPCVDFAEDKRKDLLQKIDSSLDDPKLSVTYRKQYIILRE
MLKDPNEPTAQYILAPFQLLPRAGPTAKDIFGMSHPGNFISIVSLLSHPLSRGSVHLSSA
DPAAAPVIDSGILRHPADLELQARHSIWMEKIPETEAMAPLLKARGHRLHTSGKVAELQK
AQDLCKELVLSMYHVSGTCAMMPREDGGVVDPRLKVYGTSNVRVVDASLFPLIPRGNIQA
TVFAVAEKAADITKEDLVRS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_138827-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	616	1.4e-175	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.03e-91	13	616	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.27e-88	13	612	2	530	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.19e-36	469	609	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.32e-33	86	331	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.66e-26	2	602	41	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27275.1|AA3_2	0.0	1	620	1	620
QGA17771.1|AA3_2	7.38e-220	1	616	1	611
CAK40027.1|AA3_2	4.02e-213	5	620	4	616
BCS13057.1|AA3_2	6.28e-210	5	620	5	617
BCS01313.1|AA3_2	6.28e-210	5	620	5	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.86e-78	12	616	1	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.93e-72	12	616	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.36e-66	17	612	36	637	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
3Q9T_A	4.05e-63	15	616	5	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.05e-63	15	616	5	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	6.86e-89	17	616	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.86e-89	17	616	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.05e-86	14	616	11	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	8.88e-84	15	617	38	633	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	5.73e-76	16	612	46	614	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000095

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_138827-t33_1-p1.