CAZyme Information: ASPVEDRAFT_137574-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_137574-t33_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	KV878132|CGC2	30979.10	4.0178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:1181436-1182371(+)

Full Sequence      

MKLSTLFLASASATAGSAATLSQVLDFGNNPGDNEMWIYVPDKLADTPAVIVALHGCLGS
AEAYYSEVADLPPAADENGFILVYPGSNDDFHCWDVATAESLTHNGGSDSQSIVNMVQYT
LDKYSGDSSKVFATGSSSGSMMSLVLAAAYPDVFSGVAAYSGVPYGCLRGSPGSSPFTAD
QACAQGEVSKTASEWKDEVGQAWPGFNGSYPKVQVWHGTADSVISPNNFDEEVKQWSAVF
GVNLTKEEQDSPLDGYTRSIFGDGSHFEAYLAEGVGHVVPTQVDSTLRWFGLI

Enzyme Prediction     

EC	3.1.1.72:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	35	235	1.4e-25	0.8105726872246696

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.13e-33	36	251	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.85e-22	21	280	34	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.37e-13	38	241	5	200	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17501.1|CE1	8.43e-183	1	293	1	292
CAC14144.1|CBM1|CE1	2.21e-102	18	292	18	291
BAP90855.1|CBM1|CE1	7.15e-102	18	292	18	291
AXF48686.1|CBM1|CE1	7.15e-102	18	292	18	291
QGA17423.1|CBM1|CE1	1.39e-101	18	292	18	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.36e-75	18	291	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8M9H9|FAEB_TALSN	1.88e-107	18	292	18	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	3.93e-103	18	292	18	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|G2QND5|FAEB_MYCTT	5.49e-91	18	293	18	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	9.78e-87	13	293	13	291	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|B8NBI2|AXE1_ASPFN	1.03e-76	18	291	32	304	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001856	0.998129	CS pos: 18-19. Pr: 0.6697

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_137574-t33_1-p1.