CAZyme Information: ASPVEDRAFT_137482-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_137482-t33_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		92103.81	4.5908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:389614-392417(+)

Full Sequence      

MHLSITSLLSTPLFCAVAVLASQATDDVSTLATEAAKASNQSLLWGPYKPNLYFGVRPRV
PNSLFAGLMWAKVDNYATAQDNFRHTCEQNEGMAGYGWDEYDVRKGGRETIHDAGNSLDL
TIDFIKVPGGQHGGSWAARVKGVPREDALPDQPTTIVFYAGLEGLGSLDVSTESDDPRGF
QGDVKVKGYTSDLGDFSIDVTTGPKSNEHPEHVHASYDDKPLDRTLVSSSTVPLEHTWQT
KALLFAQMKEAVDETIGKYGTESPPPPAQVFTIRNSPGDGNMQFVQKVFSGAFEFDVLFS
SGSSPKPLTSEILTSEIRGASLSFSERFKKILSPQSPFNTAEYIEFSKSMLSNLVGGIGF
FHGTDVVDRSAAPEYDEENEGFWEEAEEARARAQPVLEGPKDLFTSVPSRPFFPRGFLWD
EGFHLVPVLDWDPDLALEIVKSWFSLMDEDGWIAREQILGSEARSKVPPEFTVQYPHYAN
PPTLFMVLEAFIDKLDAKEESAQTYREDHEGLHSVYVKKPELGEDFIRSIYPLLKKHYFW
YRSTQNGDIKSYDREAFSSKEAYRWRGRSVQHILTSGIDDYPRAQPPHPGELHVDLISWM
GMMTRALRRIADTLGETEDAEEFKTYETAIERNIDDLHWDADAQTFCDATIDEYEESVHV
CHKGYVSIAPFLTGMVGPDSPRLKAVLDLIEDPEELWSDYGIRSLSKQDEFYNTAENYWR
SPVWMNINYLILKNLYDIALAPGPQQSRAAAAYTNLRKNLVENVFREWKETGFAWEQYNP
ETGKGQRTQHFTGWTSLVVKMMSMPEVPASERTGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	591	802	1.9e-33	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	308	804	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.08e-127	43	266	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	4.52e-07	524	736	358	549	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	5.60e-04	557	799	306	537	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17840.1|GH63	0.0	1	818	1	818
UDD57712.1|GH63	0.0	1	818	1	817
CAL00956.1|GH63	0.0	1	818	1	822
QRD84190.1|GH63	0.0	1	818	1	817
BCS02288.1|GH63	0.0	1	818	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.77e-173	37	802	9	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	3.69e-138	43	803	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.29e-244	28	803	27	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	7.91e-174	19	802	19	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.30e-139	43	803	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.01e-132	45	803	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.65e-131	43	803	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.155885	0.844092	CS pos: 21-22. Pr: 0.7757

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_137482-t33_1-p1.