CAZyme Information: ASPVEDRAFT_136716-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_136716-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		37934.38	3.8925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:443077-444132(+)

Full Sequence      

MKPLQLLPILLTANASPIPLFGPGGLPDLLGSLFPGLLDPDDGDIDPGLSPDPGSGIPSL
QGYTLTWHDEFTNTNSDSYLPSSNWLFDTGTSYPSGASNWGNNELQTYTTSPSNIHITPS
NTLQITPRYLPNQDDESGTHWTSARIETTDSTFHAPPGGKLYIESRLRTGCAPSEQQHGI
WPAFWALGASFREDPTYWPMASEWDIVEVVNGEPMVYNTVHCGTETREGGPCNEYTGLGN
GGVGWAGCDWHVVGFEVDRSAADSGSGTSTGGGWEGETLKWFLDGEQVHTVSGVDVGDEQ
VWESVAHQGHFMLLNVAVGGNWPGYPDENTLDGEDVALEVDYVRVWNSLDS

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_136716-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	67	346	8.5e-53	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	6.52e-120	62	347	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	5.16e-48	67	346	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	1.55e-16	69	346	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185694	GH16_CCF	5.14e-06	65	346	1	329	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
225182	BglS	1.78e-05	178	345	131	262	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17820.1|GH16_3	3.91e-212	1	350	1	367
EAA58149.1|GH16_3	6.41e-167	4	348	31	382
QKD60230.1|GH16_3	4.79e-107	62	349	29	302
QGJ01380.1|GH16_3	3.15e-105	80	349	45	302
CCT75102.1|GH16_3	3.15e-105	80	349	45	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	6.11e-66	54	348	1	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	1.39e-53	62	345	8	273	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
3ATG_A	2.09e-34	65	348	5	240	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	2.40e-32	64	346	8	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
2VY0_A	2.84e-30	63	347	13	260	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27082|CFGA_TACTR	4.65e-17	63	346	25	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
sp|P45798|GUB_RHOMR	9.02e-17	63	346	40	282	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
sp|Q9ZG90|KSBGL_SPHMU	2.95e-07	159	346	135	287	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000780	0.999164	CS pos: 15-16. Pr: 0.9604

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_136716-t33_1-p1.