CAZyme Information: ASPVEDRAFT_136614-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_136614-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		60015.78	5.1709

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878132:982127-983710(+)

Full Sequence      

MPTFRLKTAFPLIALFTIGLFFWCIQRYDREALLRLRHPVDRVGSSGAPQIQLQPTPPSS
NSNSNSKQCEVENIMPPLPFNEWLLRKNYTRAYFRPNFLPPKTEFKSLEDISVPVLPPTT
VLERGMVISPANHEDGMACPPVIDVDVAADHDIDETDKLLFGLATSADRLDRLLPSLLYS
YGNTKAGVIVLVPNSDDDIAKQETYFRNRGLDLRLIKSPLDFTARYFGLVQAFAEIIRTE
RPQTKWLGWIDDDTFFLSLPTISHELKLFDANKKHYIGALSEASWQVDNFGHIAFGGAGV
FVSKPLLDTLETYYDECQSWGEQPGDQKLGQCIQRFGDTPLTLWPSLYQMDMQGDVDGVY
ESGRKIESLHHWNSWYTKDVVKMTSAAAAAGRRSILRRWVFDQEEIINNATGKSIRTFWV
FTNGYSLVKYTYDENTPDDAIDFDHSEKTWEEDPRGYEARLGPLRPKDHPGVTKDRWLLR
ETFVVGDNVHQWYVREEDEGHSVIEIVWLGPKGGGGAGVRDFTVNIH

Enzyme Prediction     

EC	2.4.1.-:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	6.74e-10	235	371	202	341	hypothetical protein; Provisional
367085	Fringe	1.16e-04	245	349	86	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	0.003	294	371	10	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17583.1|GT31	0.0	1	527	1	527
EAA60099.1|GT31|2.4.1.-	0.0	1	527	1	521
BAE62723.1|GT31	0.0	1	527	13	536
QMW32971.1|GT31	0.0	1	527	1	524
QMW45004.1|GT31	0.0	1	527	1	524

PDB Hits     

ASPVEDRAFT_136614-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPVEDRAFT_136614-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000002

TMHMM  Annotations     

Start	End
9	26