CAZyme Information: ASPVEDRAFT_133568-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_133568-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		79431.28	4.8590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878130:71436-73565(-)

Full Sequence      

MKFFHLWAASIALSTATASLVSSDFQIDIDDTTGALVGLRDPQANASSMSWVGSPTNTPW
LPLGSRWGLGFADLGADFLHRFYWHDPQKSASNNKASHAVSYTAGPLRLDVDRYLSDDGS
FTEKYTFVNKGNESLNLAETKSHAIAIYTPFNDHYTNTSDSIHHRAHAHVWANGGANAWV
KMDQMGGLGRNLGLVLTKGSLSGYSIESRDIVTMSNTRGVFLLHPNIPTLEPGESATIEW
TLFWHSDWEDFFDQCAERSDQFIRFDIPSHTLIQGEEITINMTGAVSEKTLVDGNSVSCN
KGTCQYTVSAGSNGQKDIQISTPTENGLQNSTIFLNTVPGLDDLVTSRVNFIIQNQQVGG
DRENPNFGGYAVYDTQAESIAFWDTSSDRTTGQERLGMGNLISRYLASHPNATAVRSSLQ
TYYEFVSLKLQGENGEVYGKPQGAGSSRERLYNWPWVIQFHLAVAKLGLELSGPVADKSP
LERFMLTLENFYETGGRELYAIGLPIFESLQFLKESGHDEYYNRALELFLDHGEFILERG
LDYPPFEVNFEQSIVAPAAVMMLELYRATGNQTWLEAGELQLDTLLRFQGKQPDYRMNSI
GIRHWDGYWFGKDRNWGDTFPHHWSTIDAVALYHYAKATGDEAYRKHADEIVRNNLALFS
PDGTAGCAWIYPLTVNGRETHYRDPYANDQDWVLNHLLYINMMDLESTS

Enzyme Prediction     

EC	4.2.2.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL27	59	698	1.4e-202	0.9967213114754099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271199	LanC_SerThrkinase	4.05e-05	510	666	96	250	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
271200	LanM-like	0.002	555	663	594	691	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29683.1|PL27	1.73e-284	282	707	1	426
UQC87221.1|PL27	1.35e-282	16	704	15	704
BAE63958.1|PL27	1.82e-239	4	700	6	702
QMW27096.1|PL27	1.36e-236	4	700	6	702
QRD81443.1|PL27	1.36e-236	4	700	6	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NO8_A	2.81e-120	11	701	13	691	Polysaccharide Lyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838],5NO8_B Polysaccharide Lyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838]
5NOK_A	5.40e-116	11	701	13	691	Polysaccharide Lyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838],5NOK_B Polysaccharide Lyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

ASPVEDRAFT_133568-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000356	0.999616	CS pos: 23-24. Pr: 0.5276

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_133568-t33_1-p1.