CAZyme Information: ASPVEDRAFT_130186-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_130186-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1482	KV878128|CGC11	165464.88	5.7371

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:1329596-1337649(+)

Full Sequence      

MSGPSPELPPRETPHIRLNSGQHDVFSDEDPPSPVSSPPPPPPPEHGRPLTPLIPQVSES
QSTGTLQTVYTTYHHGSTEFLIPPRPHRTRDELASPNLSVLSSRRTSWDSEAGSYDTRGY
SQSRVPSRAESDENDVNTQTVTEKYNITPTDGLLLFPEDVEKDDYLHNPDPSDRERECDI
WNRRGLINVGGLILLTIGFLVLFIGYPVITAVRGLDKHESHYPDTPKSAHTMIAEDGKEL
KLVFSDEFNTPGRTFYDGDDPYYQAVDLWYGVTQDLEWYDPDAAITKDGMLELKFDKFPN
HDLKYRSGMVQSWNKLCFSGGRLEASISLPGDGEVSGFWPGFWAMGNLGRPGYAASTEGM
WPYSYYDGCDAGITPNQSSPDGLSWLPGMRLPACTCPDADHPSPGKSRSAPEIDVIEASV
APLVGNEAKVVGTVSQSLQMAPFDIWYMPDYDYAAVYNQDITAINNYRGGTYQQAMSGET
NLNNKWYNGKEYQTYAFEYTPGATGNVTWFVGEDKTWTLDGRAIGPNANVGQRTIPMEPL
AIVMNLGMAYSFAPVDDGIEKLMPGYMRFDYIRIYQDPDDINVTCDPPGYETTEYIANHP
LAYQNFNKTTCRSSPEGCSSLWFLMLMFLILIIISIDSPGTLFTNSDFIQSSALKTWKHT
SFNRSSRFRLFHASKMSSQPKKEPNARSRRAARACARCHSRKVRCDGSITGFPCTNCRLD
GRSCTLHSGKRDKEKQMLKAIARERGLNHCPTPNTGTKLHPQQTGLTFVRSQTALRVPIQ
EVLDIFTKHYFLYVHPCLPVVDEAVFWRKYRSVDASAGKISTLLFQAMLFAASPFVPVET
VKECGYDSLLSARDDLYRRAKRLYETGVEKDRLVTSQACLLLAYYTTDAERSHNSRWLRI
AIRYAKKERAHIYHHLPQTGLGPGRRTSDLKRLWWCCIIRDRIISLGMRRPIQITPDQFD
LHQLGLSFRDLEEECYHSEVYTPDTKIALCRILASLCHLVVAVTDLIMLVYPTTQGMPFS
LTDRQIQLDRLEETKFALLDWELSWVANPDGKEYYIHPSLTLYTNLCAIYFQSARIALCN
RICLLIGYNTYLSDETDLCRIESCRAELATAIRSTADNVKQLLLNGVADKLPISAVAYTL
LPQILLSIQTQLSTTPEDKQLHEVMLVFFTEAFRFLRSQYYMSLILAVSWKALELCRPAS
PAPLQSSDLSNASNGSSSSSSNSNGNQLVLKPPFFTDLTANDLYCHPNLFQLKLTEYIRL
LSYVDEFMSLRRAPGFGDLIYPSPAVQLQLQMPTDSYSQSYPRSYSQSSSSTSASSIRQR
AAITAAAATTDSPHDSSTIYSGDGETEDSTSPRWTEDYFWVYFGEKELEGESPQTTTTST
TTTTDPTTISNGSSSNRSSSNSDSSSSTAGSNMPGHEERYSSGLGATSGGSPHCISSSPY
DKSVTGSEPAISVKNKGKEKSSDGPRADTLQNMLDCLPLLGE

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_130186-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	246	575	1.4e-144	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	153	610	1	483	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	2.84e-160	242	576	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	9.39e-60	223	589	32	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
213391	fungal_TF_MHR	3.59e-31	778	1183	1	394	fungal transcription factor regulatory middle homology region. This domain is present in the large family of fungal zinc cluster transcription factors that contain an N-terminal GAL4-like C6 zinc binuclear cluster DNA-binding domain. Examples of members of this large fungal group are the following Saccharomyces cerevisiae transcription factors, GAL4, STB5, DAL81, CAT8, RDR1, HAL9, PUT3, PPR1, ASG1, RSF2, PIP2, as well as the C-terminal domain of the Cep3, a subunit of the yeast centromere-binding factor 3. It has been suggested that this region plays a regulatory role.
185693	GH16_laminarinase_like	1.70e-20	244	575	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57990.1|GH16_2	0.0	1	1378	1	1396
BCS26428.1|GH16_2	0.0	1	610	1	635
BAE59904.1|GH16_2	0.0	11	610	11	640
QRD86509.1|GH16_2	0.0	11	610	11	640
QMW42142.1|GH16_2	0.0	11	610	11	640

PDB Hits     

ASPVEDRAFT_130186-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	1.81e-147	149	610	205	694	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|O13941|YEPB_SCHPO	1.25e-142	161	610	132	610	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87024|SKN1_CANAX	6.17e-142	155	609	237	720	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	1.82e-140	149	610	231	724	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P33336|SKN1_YEAST	1.66e-138	149	620	245	765	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
186	208