CAZyme Information: ASPVEDRAFT_129653-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_129653-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		33414.77	4.0676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:1036608-1037623(+)

Full Sequence      

MVPLRHILSVLFYALACSAFTLSRRAPTPGELSQVTDFGENPTNVGFYIYVPQNLATSPA
IVVAIHYCTGTAEAYYTGTPYAQYAETHGFIVIYPESPYEGGCWDVSSQSSLTHNGGGNS
NSIANMVTWTIDQYNADSSRVYVMGTSSGAMMTNVMAATYPELFSAGIAYAGVAAGCFYA
EADEQAWWNSTCSTGESVSTPEHWAEIAKAMYPDYDGDRPKLQIYHGSQDTTLDTQNYYE
TCKQWAGVFGYTYDSPQETQNDTPLENWDKTIWGPNLQGILANGVDHNIQVQGDEDLKWF
GFTS

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	44	256	2.8e-23	0.8634361233480177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	6.42e-32	48	262	2	210	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	1.44e-25	12	182	19	190	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.38e-23	49	237	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	5.50e-09	82	246	7	167	Prolyl oligopeptidase family.
226584	COG4099	4.34e-07	132	186	262	316	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS18359.1|CE1	3.03e-225	1	304	1	304
ABF50875.1|CE1	5.45e-187	1	304	1	304
EAA58068.1|CE1	5.61e-185	1	304	1	306
QMW35424.1|CE1	7.71e-167	1	304	1	307
QMW47486.1|CE1	7.71e-167	1	304	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	4.93e-147	30	303	2	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B037|AXE1_EMENI	9.69e-188	1	304	1	304	Acetylxylan esterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=axeA PE=1 SV=2
sp|B8NBI2|AXE1_ASPFN	1.37e-167	1	304	1	307	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	3.92e-167	1	304	1	307	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	3.92e-167	1	304	1	307	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|Q0C8Z1|AXE1_ASPTN	3.37e-155	1	303	1	311	Probable acetylxylan esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004062	0.995901	CS pos: 25-26. Pr: 0.8159

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_129653-t33_1-p1.