CAZyme Information: ASPVEDRAFT_129486-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_129486-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		92308.33	5.2595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878128:2085975-2088745(-)

Full Sequence      

MALIDVDKVLAKLTIQEKIQLLSGEDTWKTSSIARLNIPSITTTDGPHGARGVSFFNGPP
GMLLPCATAMGATFNRDLICRAGTMLGREAREKGCQILLAPTVCLQRSPLIGRGFEAFGE
DPWLSGTLASGYINGVQSEGVGCAIKHYAAHNQSSDSHEDSIWASERTLREVHLLPFQIA
TKQSNPWSYMTSYHKINGVHTSEDPWLINQVLRDDWGWDGLVMSDWFGMCSTAASLNAGM
DLEMPGPPRWRGQLLLWSFLAGKVKLQTIDFAVRNLLNLINKVQPSLKPVDPLDVAVGDT
PEKRELCRRVAAESIVLLKNKKNLLPLDPKSGGKTYGLIGPGALYPAVSGGGSADLVGYY
VSQPLDALKELVGAENVTANVGCYGHRFSPLLESSITVPGTNQPGYYLEYFMQQPDSSGS
IEPLVTTTTTQAQMYFADNLPEGITAGYWLRVSTTYTAEETGMIQLGLCVLGKGRLYIDG
VEKIDLFTSQPEKTLQTPMFNQASMEVTTVLDAQKGQKYQIVVLLQNEHLIPGIGALNAG
GLRIGCCEHFDPDAKLSDAVEVARSVDYPIVIAGLNADWESEAMDRESLSLAPQVDRLLE
AVLKANPNTIIVTQAGCPIALPWLDSANTLVHAWYGGQETGNAIMDVLFGKVNPSGRISV
TFPNRIEDNPAFLSFGKVDKMLYYGESVFIGHRYHEKLQIPPLFYFGYGLSYTTFAYRDL
KVPKTVDLASQDTFKVSVTVQNTGTRDGAEVVQVYVSDVKSYVQRPARELKGYSRVNIPV
GGTVNVPITLDKYALSFYSQEHAQWVAEKGMFDIIIATSADPKDELLRQRFELVADYLWS
GL

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_129486-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	245	7.8e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.34e-74	34	833	100	764	beta-glucosidase BglX.
224389	BglX	1.14e-71	9	378	34	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.62e-47	543	712	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.01e-45	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.54e-38	13	791	60	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92226.1|GH3	0.0	6	842	7	845
QKD58970.1|GH3	0.0	3	842	4	848
UPK96510.1|GH3	0.0	1	842	1	823
UPK98381.1|GH3	0.0	3	842	4	848
CEI68123.1|GH3	0.0	3	842	4	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.76e-199	1	842	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.54e-194	5	842	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.13e-130	4	829	3	664	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.57e-110	13	820	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.03e-90	8	810	56	807	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WLY1|BGLJ_ASPFU	1.30e-221	6	842	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	3.66e-221	6	842	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|A1DNN8|BGLJ_NEOFI	5.01e-221	6	842	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.30e-206	1	842	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.30e-206	1	842	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000075

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_129486-t33_1-p1.