CAZyme Information: ASPVEDRAFT_124007-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_124007-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	KV878126|CGC9	41651.28	5.5151

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878126:2797694-2798994(-)

Full Sequence      

MKTFYTLLALIQAATAQVKGTPSGFAAGTTGGGSATPAAPSSLAQLKEWITDSTARVILI
DRTWDFAGSEGTTSTQCCSTRTTVCSGGTSAGQAWIQDTCTDGTWVSCTYDNAARSPLDV
GSNKSIVGVGSAGVIKGKGLRIRGGNSNVIIQNVHITNLNPQYVWGGDAITLDGADYVWI
DHNKVYPSTEVSTISLIGRQMIVSGWGTAGHVTISNNEFDGRTSWSSGCNGKHYWTLLLI
GLEDWYTFSNNYLHDLSGRAPHIGTDYTDSKIFLHAVNNYFKDIGGHAFDIDTNTWSLLE
GNYFDSVTTPLTPDSLTSGAQIYDVATVAAAGNCVGQLGYICEWNRLSNSGTWTDRTDAA
VLSQAAAYKGSLIGHIGVADVPSTVVANAGVGKI

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	108	305	1.6e-81	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.60e-40	106	307	2	189	Amb_all domain.
226384	PelB	2.38e-19	102	394	82	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.32e-17	111	304	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20248.1|PL1_4	3.28e-206	4	394	6	387
UPL00849.1|PL1_4	1.29e-201	3	394	4	389
UDD64891.1|PL1_4	7.61e-199	10	394	14	391
QMW47813.1|PL1_4	4.39e-198	10	394	14	391
QRD93342.1|PL1_4	4.39e-198	10	394	14	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.97e-80	16	366	1	334	Pectin Lyase B [Aspergillus niger]
1IDK_A	3.33e-79	18	394	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	2.08e-77	18	394	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	2.67e-16	109	307	57	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.45e-07	111	304	69	276	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFF7|PELF1_ASPTN	1.28e-215	3	394	5	388	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|A1DEH0|PELF_NEOFI	1.77e-210	1	394	1	386	Probable pectin lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelF PE=3 SV=1
sp|B0Y0L8|PELF_ASPFC	5.08e-210	1	394	1	386	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	5.26e-111	18	394	23	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	3.37e-108	9	394	16	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000292	0.999679	CS pos: 20-21. Pr: 0.8936

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_124007-t33_1-p1.