CAZyme Information: ASPVEDRAFT_122154-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_122154-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	KV878125|CGC36	54432.32	4.8781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:3175854-3177517(-)

Full Sequence      

MGSIDSPHLPPDFLWGFATASYQIEGAVDEDGRGPSIWDTFCKKPGKIAGGANGDVACDS
YHRTHEDIALLKECKAPAYRFSISWSRVIPLGGRNDPINEKGLQFYVKFVDDLLAAGIIP
LVTLFHWDLPDELDKRYGGLLNKEEFVADYANYARVIFNALSHKVKYWITFNEPWCSSVL
GYNVGQFAPGRTSDRNKNPEGDGSTEPWIVGHNLLVAHGTAVKIYREEFKERDGGEIGIT
LNGDWAEPWDPSNPADVAAAPRKIEFAISWFADPIYFGRYPDSMVAQLGSRLPEWTPEEV
ALVKGSNDFYGMNHYCANFIRAKTGPAEPTDVAGNLELLLQNKAGEWVGPETQSPWLRPS
PIGFRKLLKWLSDRYGRPKIYVTENGTSLKGENDMPLEQLLKDDFRVEYFEGYVRAMAEA
YAVDGVNVRAYMAWSLMDNFEWAEGYETRFGVTFVDYENDQKRYPKASAKAMPEIFAKYI
QKA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	477	1e-159	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	9	470	5	442	Glycosyl hydrolase family 1.
274539	BGL	9.50e-173	10	470	1	424	beta-galactosidase.
225343	BglB	5.67e-141	9	469	4	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	5.02e-120	10	469	31	473	beta-glucosidase
215435	PLN02814	1.05e-108	9	469	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26295.1|GH1	0.0	1	483	1	483
EAA65642.1|GH1	0.0	6	481	336	811
QRD82378.1|GH1	0.0	1	483	1	483
QMW27934.1|GH1	0.0	1	483	1	483
UDD55888.1|GH1	0.0	1	483	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	2.71e-275	6	482	23	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	4.81e-242	9	482	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	5.30e-239	9	482	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.06e-238	9	482	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.24e-234	9	483	9	473	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	1.02e-198	9	480	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	5.79e-174	9	481	6	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	3.09e-141	4	482	17	517	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q9M1D0|BGL16_ARATH	5.41e-141	10	470	36	494	Beta-glucosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGLU16 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	5.41e-140	10	469	40	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_122154-t33_1-p1.