CAZyme Information: ASPVEDRAFT_121716-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_121716-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	KV878125|CGC30	91358.13	5.8938

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:2934563-2937273(-)

Full Sequence      

MGFKSVDSAHIESTLSKLTLEEKISLLAGKNFWETFDFPEKGVPALKTSDGPNGARGATF
KGGVTAACFPASSLLAATWDVEAAKHIGNALAEETLSKGARVLLAPTVCIHRHPLGGRNF
ESFSEDPFLAGKLAAQYIHGVQDRGVAATIKHFAVNEQETCRFTVNEHVAERALREIYLK
PFEIAIKESQPLAVMTAYNLVNGTHADSHEFLLRKVLREQWGWKGLAMSDWGGTNSTVES
LNAGLDLEMPGPTRWRKVDEVVAAVKSGAVSEKTINQRARNVLELLAKLNCFEDPTIPDE
RAIILPEHKKLIRSVGSQGLVLLKNDGAILPLKKEKLAKKKIALLGFAREALIHGGGSAS
VNAHYRVTPEEGLRAALGDSVEFEYAKGAHTFRQLPLLSEGVVNREGQPGWTFDFFVADE
PNGEPASSTSSEQPSYIPIFVKESWGSLRASARFTPTQSGNHYLAMSGLGASKILIDGKI
VYNQKQNCPDSMAFLLGGVEEPEIQYVFEAGKTYTIEITTVKPTSKGGLAMLDGFIGFRF
GFMSEQEHNQDLLSEAVEVAKKSDFAIVFTGHTSAWETEGQDQISFNLPSNGSQDRLVAA
VGAVNANTVVVNCTGVAVAMPWLNEVKAVIQAWFPGQEAGNAIADVLTGAVNPAGRLPVS
FPRAVEDAPAHGNFPGEFSTGEDGRQTLEVTYKEGVFVGYRHYDLSEENRSKVLFPFGHG
LSYTTFTHGNHKVSIAGGDSVEVSVDVTNSGTYTGAEVVQVYAGSKLAVPENPTKELVGF
VKVRLEPGETKTASVTFSTRQLAHFNEQNSKWEVPSGEYEVSIGQSVRDIIGKAVVNVGA
LSYDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	250	9.9e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.76e-81	69	824	120	751	beta-glucosidase BglX.
224389	BglX	7.43e-66	42	329	59	347	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	9.17e-51	545	700	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.78e-43	42	285	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.29e-40	8	824	50	769	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS18431.1|GH3	0.0	1	845	1	845
EAA65189.1|GH3|3.2.1.21	0.0	1	845	1	845
ABF50843.1|GH3|3.2.1.21	0.0	1	845	1	845
UPK99435.1|GH3	0.0	8	844	3	833
CEI64461.1|GH3	0.0	6	845	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.91e-176	11	831	6	829	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.35e-172	11	831	6	829	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.97e-134	11	840	5	670	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.71e-118	14	838	8	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.02e-115	11	839	4	714	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	1	845	1	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	9.63e-201	11	830	2	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.16e-195	11	843	6	834	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	7.04e-194	11	823	6	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.26e-194	11	823	6	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000018

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_121716-t33_1-p1.