CAZyme Information: ASPVEDRAFT_121552-t33_1-p1

Basic Information

• Species: Aspergillus versicolor
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus versicolor
• CAZyme ID: ASPVEDRAFT_121552-t33_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741		81583.62	6.7558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AversicolorCBS583.65	13364	1036611	142	13222

• Gene Location: location=KV878125:22663-24888(-)

Full Sequence      

MTQNIDFQTAVESVKSGQDPSLAARELLHELNEEERLGLLHGDPGFWEGMHKLYTGYYLA
NPYVHGEIKRLGIPGIRYCDGPRGVNINKATAFPVSMARGATWDPRVEERVAEVIGLEAR
VYTANTVGSASINLPRHPAWGRVQETYGEDPLLLGEFGAAHVRGLRPNVMACVKHFALNS
METARFRVNVHVDEAALYELYLPHFKRCVEEGAPVIMSAYNSVNGEWASENQHLLTNILR
NLWGFKGVVISDWVFGVRDGVKSVKAGLDIEAPFRNRREASVRPALDSGELSWTEINQVA
HRILTIQLLHYATRNPEEPTIDVVFNKASRQLAREVASKSMVLLKNAQVNGERLLPLPER
LGSLAVIGRLATSRQTGDRASSLVACPEVISLYDGIKDALPHVRILLSDSDNEEGAVSAA
TKADVVVLVVGYDAEDEGEFLRPSRETDPSAQALLPEPDDSYWARRVQSARKAAVKSAAT
ASPGEPEELQSRPTGGDRRSLRLRDEDVRLIHAVATVNPRVIVSVITAGAIIAEEWRFKV
PAFLVSWYSGCEGGRALADVLTGAVNPSGHLPWCMPRSEAGLPEFDANANEITYTKWVGQ
RLHDRRGVTAAYPLGFGLSYTKYLVERAVIGGAHTQGIRLQVQVRNVGERAGRCVVQVYG
CPKFRTAADDFPTRVLAGFQAVELRAHEAKSIEVVAASSPFHRWVNGQLLWDVTQVVLEV
GQFSGDPEAVKVLYHPLTSRM

Enzyme Prediction     

No EC number prediction in ASPVEDRAFT_121552-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	272	3.4e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.00e-73	91	724	118	747	beta-glucosidase BglX.
224389	BglX	4.47e-62	67	377	54	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	7.73e-55	66	695	74	741	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.59e-41	341	620	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.13e-37	70	306	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52038.1|GH3	8.74e-312	1	735	1	742
UPL03152.1|GH3	1.15e-311	1	733	1	738
UPL03376.1|GH3	7.06e-301	1	732	4	741
UQU67868.1|GH3	1.21e-241	7	730	6	721
UPK96878.1|GH3	2.11e-241	4	733	13	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.16e-81	25	732	6	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	6.60e-75	26	695	6	671	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.92e-74	26	695	6	671	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	9.58e-67	24	726	54	819	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	7.51e-66	68	733	32	661	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	2.66e-80	25	732	6	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	9.18e-73	26	659	4	734	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A7LXS8|BGH3A_BACO1	1.73e-69	70	724	75	727	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	3.51e-67	27	694	14	795	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|F6C6C1|APY_BIFBA	8.70e-62	68	726	32	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPVEDRAFT_121552-t33_1-p1.