CAZyme Information: ASPTUDRAFT_936994-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_936994-t33_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		65449.17	5.1720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878207:818710-820602(+)

Full Sequence      

MTSSPITPLEADYVIIGGGTSGPVLAARLSECDSNRSVIVLEAGKNLIDDPRVQTPALWT
TLMGSEADWQFQSTPQAALNNRVIKETQGRFLGGSSAINGQAFIAPTKAGIDAWDKLGAT
GWTWENLAPYYKKVTTLQLPDEDTRGHIGVSWVDPEVNGNSGPIKVSFPAVKESPLAKAW
VDTFQEMGYGCTADPFSGVSTGGYSNLASVDFEKKQRSYAATGYGLPAMERRNVRIITEA
TVQRILFSTKESGATATGAEARIDSQIVTMKARKEVILTAGALNTPKLLELSGIGNRHIL
DQYSIPVIVENRNVGENLQDHLMTGISFEVKPGIATGDPLLRQEPEAIKTAFQLYSEQKA
GPMTIGGVQSSAYMPLTEYSGQPEARMAYFDSFPPDLNERDQVIRDIYAQEHEPTCQMFM
FLAQANLHESGKSFVGQKLLPGNFLSLGIIQTLPFSRGAVHIASADPTVSPIIEPRYFSN
PLDMDLMARNLLSLERLHSVKPIADYLVEGGRRNHPDAFLTDLESAKKYLRDTATTSYHL
SGTAAMLPQEKGGVVDENLRVYGTTNLRVCDASIFPLMTTANPMSTVYAVAERAADIIKA
GQ

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_936994-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	600	1.1e-175	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.17e-105	9	602	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.42e-102	10	599	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	8.34e-41	454	594	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.55e-34	77	322	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.08e-30	12	587	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02826.1|AA3_2	0.0	1	602	1	602
BCS14479.1|AA3_2	0.0	1	602	1	602
CAK46356.1|AA3_2	0.0	1	602	1	602
QDL52568.1|AA3_2	0.0	8	602	9	603
QSS68114.1|AA3_2	1.28e-265	8	599	7	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	6.98e-83	12	599	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.97e-66	10	602	1	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.27e-65	10	602	2	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	7.84e-65	10	598	35	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	4.02e-64	13	599	8	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	4.10e-99	12	600	15	618	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.19e-93	12	599	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.19e-93	12	599	15	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.85e-90	12	598	48	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.85e-90	12	598	48	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_936994-t33_1-p1.