CAZyme Information: ASPTUDRAFT_877664-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_877664-t33_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197		23303.48	7.4711

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878208:47003-47596(+)

Full Sequence      

MMKIYNALGLNYEVSDLYYYRKVLIKMYWDDSTTLNVIAHIGDFFCLGHSMAAKFQSLLF
VVLVKLSEKKKFGGTAAFNCYLTMPFDKRARIEIENENDEAYFQYFYIDYELYAEPLPAD
TLYFHAHWRRMTPTNGWASSRIQTDSLETQIPNFDGKVNYVIWETEGAGQYIGCNHSVAH
FQGTWWGRRRRHDLHRR

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_877664-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	20	187	1.1e-37	0.6016949152542372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	7.10e-50	21	187	1	138	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39208.1|GH172	4.17e-119	1	187	81	267
CAP93243.1|GH172	6.43e-114	1	187	81	267
QKD59092.1|GH172	2.59e-109	1	187	86	272
QKX59927.1|GH172	5.11e-108	1	187	83	269
UPK94269.1|GH172	1.24e-106	1	187	85	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	2.04e-62	1	187	83	269	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	5.05e-19	23	187	76	231	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

ASPTUDRAFT_877664-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000013

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_877664-t33_1-p1.