CAZyme Information: ASPTUDRAFT_80341-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_80341-t33_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		64698.05	5.1520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878179:745743-747784(+)

Full Sequence      

MATTAYDFVIIGGGTAGLVTASRLSEDPNTSVLVLEAGADLTADPRVNIPIFYAALLGSD
ADWKFQSAPQPGLNGRVIGLNQGKTLGGSSSLNAHVFVPPFKGAVDSWEELGNPGWNWTT
LKDYMTKAYSSPTVAQDVKESLAIDDWPELNGAKGPIQTSFGNETHPIRKAWAELFRSHG
EYNGGDPFIHSSVGSFSCLASIDSEGKRSNSALAYYKPVELRQNLHVLTNALVERVLFDE
SKPPRAIGVQYIHDGASKTVQAKSEVILAAGVFQSPKILQLSGVGGADLLNKHGIDVVMD
LPGVGQNLQDHMISYTAFQAKPELETKDSLVRQEPEAIGQAMQEYAATKSGPLASLGVHT
YAYLPLPEQDRSDLQALFTSDAAVKSQHKATQSYYDITKTTILDPKQPSAAYLSALGQTN
YAKDLRDGTIPDASPGKFVTLGVMLSQPLSRGSVQITSNNPEAPPVIDPGYMSNPLDLEV
MARHLLRIKKLAESPQLGELLEQPLKFRDPDADFQGDLDAAKKYARDNLVSMWHLAGTCS
MLPLEKDGVVDSNLKVHGIEGLRVVDASAIPLISTANLQATVYAFAERAADLIKQDRKSE

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_80341-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	596	3.8e-179	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.42e-118	1	594	1	532	choline dehydrogenase; Validated
225186	BetA	9.63e-102	1	598	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.09e-41	448	589	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.18e-32	74	313	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.30e-30	4	582	54	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16880.1|AA3_2	0.0	1	600	1	600
BCS05325.1|AA3_2	0.0	1	600	1	600
QMW48092.1|AA3_2	0.0	4	600	3	599
QMW36031.1|AA3_2	0.0	4	600	3	599
QRD93013.1|AA3_2	0.0	4	600	3	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.52e-79	1	599	1	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	5.79e-76	6	597	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.63e-75	6	597	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.90e-69	6	598	6	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	4.85e-67	6	594	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.29e-91	4	596	12	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.29e-91	4	596	12	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	5.87e-88	1	596	9	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.59e-86	6	593	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.59e-86	6	593	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000027

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_80341-t33_1-p1.