CAZyme Information: ASPTUDRAFT_79749-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_79749-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059	KV878177|CGC5	115748.47	4.2663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878177:1665377-1669321(-)

Full Sequence      

MYTQPWHGLAAIATIGSCVIASPLAPWELRGNASMQSAHLMGIRDTDEFDPAELSHITKL
AAIGDSYSAGIGAGSRLGNIGEALNSKSIISDVINDQIPNLNGDQQVILLSAGGNDAELS
NILNQCIYQWAVLNHTQVLVAKAAALANLEYGWMADIDWDALARGCDGQLEHTNRLINGD
AFSKSLDNVIAAAKKKLGSNGMIYYTGYAKFWAEDLSPACDKVSWSTWIHDTETLTSAHR
KTMNDLVDSVNEKISSAVERAGAQVKFVDYDSYVGYFNGRFCEAGVDESTSDSNTREGLM
FYELNTWDPLGSNPHKRSQDRPLEGTFEGSVNEYAEITKLLDPDAQFSKQTSVSDDTTDM
TLVESKLSLSTVSESSDIEVPNVLPDGYGRVFHPQIQLHELIANLVIYEMTNKNELDNGY
PEIQEKFTFDSCPWTPADVDDDESMDAGGQQIALASYINPLSDPTAWTRMIDYPSGMVTV
LVANVLNGPDTTVDEDWEKVISRANTAGKRVLGYVRTGYLGLSQYQFQTRLGSSGLADWV
SQIQTDVDLWYTLYPGMIGGIFFDEGWNQCGDDNVYSDLYRFITDYTKRMHPGAFTVLNP
GATMPQCFEHSADTLMTFENSYDTYMNNYSPNPDWTPSDPRKLWHIIYNVPSDSVGKVAE
LALERGAGLIHITNDNLSNPYDTLPDDDYMQNGQSASAPGSLAVTASDYSSVSLSWGASS
PAPYAYSIYQNGKEVARLPGSITKVTIGNIDHGTSITFTVKAIGSGGSASGNSNSVEATT
LELPDNQPVTNVKSSSTATKTTVQADILIPFAFQRVFLTDPDTACEMPAWPINYNLGNYI
CTHYMVESGTLFKYSGAELPAGQTNYPWAWTSMGTVPVSRSGYTWTWELPIGSDTVNTNY
FVVEAQGYGPLTNVFHPCPSTWDDATLSSGAYCTGNSPYDCKGATLCSTLNVKWCDKAVN
QMNRGSTLYTANAEALALSGNCWANWEQFGCSVKIRGKDENGKECTITGDEMWEAYQDIR
KIGGCKKCGSKHIGFGCLVSVDYYYGCDNRDSGVNAIDV

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_79749-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	454	685	1e-20	0.9493670886075949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	1.16e-51	457	687	1	230	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
406036	MU117	4.43e-27	940	1047	1	104	Meiotically up-regulated gene family. This protein was identified as being up-regulated during meiosis in S.pombe. This family of proteins is found in largely in plants and fungi. Proteins in this family are typically between 128 and 920 amino acids in length.
238861	SEST_like	5.76e-17	59	285	2	224	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
238020	FN3	0.003	697	763	2	77	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	0.0	1	1059	1	1119
BCR99052.1|GH0	0.0	1	1059	1	1119
UNO38501.1|CE3|GH0	2.67e-126	446	933	493	1000
CCT67685.1|CE0	2.15e-112	7	437	6	461
QGI80975.1|CE0	2.17e-112	7	437	6	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C5G_A	5.61e-07	451	656	9	211	Crystal Structure of Aspergillus clavatus Sph3 [Aspergillus clavatus NRRL 1]
5D6T_A	6.59e-07	451	656	27	229	Crystal Structure of Aspergillus clavatus Sph3 in complex with GalNAc [Aspergillus clavatus NRRL 1]

Swiss-Prot Hits     

ASPTUDRAFT_79749-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001949	0.998026	CS pos: 21-22. Pr: 0.9580

TMHMM  Annotations     

Start	End
5	27