CAZyme Information: ASPTUDRAFT_79126-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_79126-t33_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	KV878208|CGC3	62860.46	5.7097

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878208:1361004-1362922(-)

Full Sequence      

MGIYTRLPESIDEVDIIIAGGGTAGCVVASRLADADPSLSILVVEGGQNNKGNHLIAFPL
LFPTALLPTSTATLFYKGNAEPQLDNREMIVPAGGVLGGGSSINLMMYSRAQRHDWDSWA
TPGWSTDEMIPFLKKLETYHGPGPDSVHGKNGPIVVSQGTAILQDLDTSNGVQRGLRFVD
KEGRRQDAASNYLHPKLEDGAHPNLHVLVETKVIKILFEGKRAVGVEFKPNPAFQKDDNT
DIRYVKARKLVISSCGAIGTPLLLERSGLGDEAILNKAGVPAVAHIPGIGRDYQDHHLLI
QAYYSALEPTETFDAPLAGRINMEELIKTNAPIMGWNGQDASCKLRPTEADVTALGHEFE
AAYARDYRSTPNKPMALMALLGGFPGEPHTIEPGQYLATSLFTVYPYARGHVHITSPDPD
ADISFETGFLKSDLDVKKLIWAYKKQREIVRRMGVYRGEFAGMHPPFAEDSAAALVRLDK
PNDKNISDIQYTAEDDKVIEGWVRKNVGTTWHSLGTCKMGALADGGVVDPELNVHGIEGL
KLVDLSIVPQNIGANAATTAYAIGEKAATIIMKDLGLAGNE

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	163	576	4.7e-191	0.7050847457627119

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.64e-87	13	571	5	531	choline dehydrogenase; Validated
225186	BetA	9.49e-84	13	578	7	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	5.20e-38	74	296	4	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.38e-34	406	567	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.20e-27	15	578	57	584	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13902.1|AA3_3	0.0	1	581	1	603
BCS02218.1|AA3_3	0.0	1	581	1	603
CAK42323.1|AA3_3	0.0	1	577	1	598
BCS22571.1|AA3_3	0.0	1	581	1	588
ANH22749.1|AA3_3	5.43e-282	1	575	1	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	2.21e-137	7	580	3	641	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	6.16e-137	12	577	5	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.23e-136	12	577	5	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	6.30e-53	13	574	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.23e-52	13	574	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	5.20e-144	7	581	3	642	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	1.13e-136	7	580	3	641	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	1.13e-136	7	580	3	641	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|P04841|ALOX_PICAN	6.54e-136	12	581	5	643	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2R038|ALOX2_KOMPC	3.56e-135	7	580	3	641	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000016

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_79126-t33_1-p1.