CAZyme Information: ASPTUDRAFT_75659-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_75659-t33_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653		70821.04	6.8638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878203:1329901-1331862(+)

Full Sequence      

MLSFWQLLQLLLATLPAAAINLTGYEYIVVGSGAGGGPLAARLALAGHSTLLLEAGTDQA
HNLNTSVPAYAALAAADDHLSWNFFIRHYADDAQQARDPKTVYTTPTGEQYVGLHPPPGS
IMKGILYTRASTLGGCTAHNALVAIYPHRSDWTYIANLTNDSSWLPDLMREYYIRLENNH
YLTPDVPGHGYTGWLSTEHAPINLVLQDPQLLSLLLGAVFTQPRTILSNLISLLLGDVNS
PSPSRDSKPAYYQTPIATSSNVRNGAADFLRIVHSATNPDGSQKYPLTIRTNCHVTRVLF
DTTSHPPQATGVSFLDGPYLYRASPLSSPNTPRTPGTATATREIILSAGVFNTPQILQVS
GIGPADLLQKHNIPVLVNLPGVGANLQDHYETSVVVEAPFPFRILNGCTFNYTSDPCLIR
WLNPKGLHKDRGIYSSAGFTSALLHHTPLPNTSTTLSPANKDDYNTIIYGGLVNFRGYFP
GFEVNLTLTHHSFTWAIIKAHPSNRAGTVNISSSDPLDPPHILFNSFSDPGSEKDLFALV
DAIRVARRALKRQLIPTWETLPGKEVQGYEELRQYVLDTSWGHHAVGTCRIGRGEGGDDE
GSVVDGKFRVRGVRGLRVVDASVLPRAQGTFPVLGVYMLAEKAVGDILGDDGG

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_75659-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	648	1.3e-91	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.50e-64	25	652	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.42e-55	25	649	6	533	choline dehydrogenase; Validated
215420	PLN02785	1.75e-30	25	639	56	568	Protein HOTHEAD
398739	GMC_oxred_C	1.32e-28	507	643	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.29e-13	287	391	142	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15218.1|AA3	0.0	1	653	1	658
BCS03593.1|AA3	0.0	1	653	1	636
QMW33146.1|AA3	1.97e-254	6	650	5	644
QRD84722.1|AA3	1.97e-254	6	650	5	644
QMW45179.1|AA3	1.97e-254	6	650	5	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.93e-39	25	642	14	521	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.93e-39	25	642	14	521	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	4.83e-39	25	642	14	521	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS2_AAA	8.57e-28	25	649	8	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.14e-27	25	649	8	562	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7FKL6|BETA_YERP3	1.75e-38	25	649	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.75e-38	25	649	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	2.38e-38	25	649	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	2.38e-38	25	649	3	533	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|Q7X2H8|CHOX_ARTGO	2.49e-38	25	642	14	521	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000834	0.999162	CS pos: 19-20. Pr: 0.9615

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_75659-t33_1-p1.