CAZyme Information: ASPTUDRAFT_61972-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_61972-t33_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		39631.85	3.6651

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878182:116025-117312(+)

Full Sequence      

MVTSSSVIILTLWAALVSASPVADPLVTPAPKLEDLEKRATSCTFSGSEGASSASKSKTS
CSTIVLSDVAVPSGTTLDLTDLNDGTHVIFEGETTFGYEEWSGPLVSVSGTDITVTGADG
AYLNGDGSRWWDGEGSNGGKTKPKFFYAHDLTSSTISGIYIQNSPVQVFSIDGSTYLTME
DITIDNSDGDDGEAANTDGFDIGDSTYITITGANVYNQDDCVAVNSGENIYFSGGVCSGG
HGLSIGSVGGRSDNTVKNVTFYDSEIKSSQNGVRIKTIYGDTGSVSEVTYKEITLSDITD
YGIVVEQNYDDTSESPTDGITIEDFVLDNVQGSVESSGTNIYIVCGSDSCTDWTWTDVDV
SGGKTSSDCENVPDDISC

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	58	374	1.3e-74	0.9753846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	5.54e-129	63	378	3	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
178580	PLN03003	3.12e-24	120	367	120	364	Probable polygalacturonase At3g15720
227721	Pgu1	5.23e-24	97	335	183	456	Polygalacturonase [Carbohydrate transport and metabolism].
215540	PLN03010	4.59e-22	101	377	124	394	polygalacturonase
177865	PLN02218	4.31e-21	112	374	157	422	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44164.1|GH28|3.2.1.15	7.66e-270	1	378	1	378
BCS07677.1|GH28	4.43e-269	1	378	1	378
BCR95111.1|GH28	4.43e-269	1	378	1	378
CAA74744.1|GH28|3.2.1.15	2.10e-267	1	378	1	378
BCS17128.1|GH28	6.39e-199	12	378	12	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IA5_A	9.11e-189	40	378	1	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
6KVE_A	1.21e-159	36	378	5	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	6.96e-159	36	378	5	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	6.07e-158	42	378	2	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	1.33e-142	41	378	1	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QBB6|PGLRE_ASPNC	1.36e-270	1	378	1	378	Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaE PE=3 SV=1
sp|O42809|PGLRE_ASPNG	3.74e-268	1	378	1	378	Endopolygalacturonase E OS=Aspergillus niger OX=5061 GN=pgaE PE=1 SV=1
sp|Q12554|PGLRC_ASPNG	6.00e-197	7	378	6	381	Probable endopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgaC PE=3 SV=1
sp|A2QL39|PGLRC_ASPNC	6.22e-197	12	378	12	382	Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaC PE=3 SV=1
sp|O74213|PGLR1_ASPAC	3.35e-195	10	378	11	378	Endopolygalacturonase I OS=Aspergillus aculeatus OX=5053 GN=pgaI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999770	CS pos: 19-20. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_61972-t33_1-p1.