CAZyme Information: ASPTUDRAFT_61058-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_61058-t33_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497		55314.98	6.0839

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878179:175710-177256(+)

Full Sequence      

MGAICLDPIARQAHRAGSSQPGPREAKSISVTQVGGARNIASRCNALNCPGQVRMALIFG
RALRGELIWSDRLALAHKHSCPQQRVLGQSVTMQLKTPIPAMPAMPAMSGVCLPRQVRRV
VPLFLAVFCLVFYLSLTGTFAEFHGGLARQSKCRLFPRKIWQSWKVNPFEFEERDLNVAR
TWTSINPGYRYEVLTDQNDLHYVETNFGPDGLNRPDIVETYRSLTAKIIKADLLRYLVMY
VDGGVYADIDVEALRPLDRFIPERFNEADMDLVIGVEIDEPDFNDHAILGPKSQSFCQWT
FISKPRQPVMMRLVNRILEWLHDHSVKQGKPISDLELDFDDIISGTGPSAFTEAVLAEMS
ARTGQEVTWKTFHDIPESKLVGGILVLTVEAFAAGQGHSDSGNHNARSALVKHHYHASGW
PNTHPRFKHPLYGEVEQCNWNKQCVADWDANTAAFAALSPEEQEQQIAMKQAADAAEAEM
AVEDLAGDDGDLGLALE

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_61058-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	177	263	4.8e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.78e-23	156	345	82	276	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.28e-15	173	263	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05523.1|GT32	0.0	1	497	1	515
BCS17076.1|GT32	2.95e-300	87	497	4	414
CAK96510.1|GT32	9.30e-291	93	497	1	408
QMW40889.1|GT32	5.06e-221	108	475	1	370
BAE58544.1|GT32	5.06e-221	108	475	1	370

PDB Hits     

ASPTUDRAFT_61058-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.16e-35	157	420	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	9.87e-32	156	418	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.08e-30	156	392	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.55e-22	157	418	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	3.72e-09	157	261	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000030

TMHMM  Annotations     

Start	End
120	142