CAZyme Information: ASPTUDRAFT_59739-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_59739-t33_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		64262.59	5.8217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878208:1013355-1015447(+)

Full Sequence      

MTVPVEDSFDFVVVGGGTAGNVVAGRLAENPDVRVLVIEAGVSNPSEISEITTPASAFGL
RDSKYDWAYKSTMINRPYYERVEKPNTRGKVLGGSSSLNYYTWIRGSKGTFDAWAEYGGP
SWSWDGCEEYFNKPATYHDDDNLYPSELSKIGRNGPLHVSHADLVPELHTFRDALTEAWT
SKGQKTCEDIYSGKMEGLTHCVNSIYGGMRSTSASYLADKPNVTILSSAIGKKINFDDNL
KATSVTVSGADRTEMTFTAKYEIIVACGVFETPKLLMLSGIGPKEELARHGIDSVVQSEH
VGQNLHDHPILAHVFRLKDGTGLDSHLLRAGPAQSAALQKYRTSKKGPFSSGLLEMVGLP
RIDDRLERYKEYREAKAQNGGKDPFGPEGQPHFEIDFVPMFSDAFQWHFPVPPEGDWLTV
IVDLLRPLSRNGEVKLNSADPHQQPYINLNFFSNELDILALREGVRFVDDILMTGNGMKE
ILGEDYPWPMPRHSDEAMNKMILERSQTGYHPCGTARLSKDIAHGVVDPELRVHGVQNLR
VVDASIIPLIPDCRIQNAVYMIGEKGADMIKAAYPALYRS

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_59739-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	572	5.4e-156	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.29e-107	6	571	3	532	choline dehydrogenase; Validated
225186	BetA	3.50e-105	2	579	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	9.41e-62	10	570	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	7.21e-45	427	565	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.44e-28	8	563	55	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02092.1|AA3_2	0.0	1	580	1	580
BCS13779.1|AA3_2	0.0	1	580	1	580
CAK97252.1|AA3_2	0.0	1	580	1	545
ATZ50069.1|AA3_2	3.88e-300	1	579	1	578
AEO67525.1|AA3_2	5.34e-296	2	578	4	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.74e-261	9	578	7	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.97e-261	9	578	7	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.42e-260	9	578	7	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.98e-74	9	572	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.08e-73	9	572	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	6.63e-72	4	573	2	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.73e-63	4	574	36	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|P64264|Y1310_MYCBO	8.74e-62	10	572	6	528	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	8.74e-62	10	572	6	528	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	8.74e-62	10	572	6	528	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_59739-t33_1-p1.