CAZyme Information: ASPTUDRAFT_57455-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_57455-t33_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	KV878205|CGC3	53192.22	4.2251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878205:158870-160684(-)

Full Sequence      

MRLSSLIPVSLLAGLAAAQLIGPVGPTTNLEDKNIECNILDYGGVADNQTDVAASIEATF
TECVLNNPKSRLVVPEGDYLIKRSVVLSNGTNWAFQLDGLITAAYGGNWTVDRELILQGF
AGEQIINSTINGEGDGKFLLDVLVIVNAVDFEFYSSNGLGAFQGQGYIYRNLDNTDRPRL
VRLISPTNASVHDLILVDSPKFHIVFDFAVNLEAYHLTIRGANLGSYDGIDAIGTNYYIH
DNEVTNRDECVSVKSPSHHALVENLVCNQAGSGVSIGSLNVSAEISNIEARNISIIQGNN
IAFIKTYPGGSGYVRDVTFENFRSLNSLYGLDINQYWQNTWEPDTGSVTLSNLIFKNFSG
SVADGALRPPLYLFASDLTFATNVTVEEFSVWTETGTKVVNKISNIFGTGDDSYGENDGI
ETLQSGEAPYTYTSTYTITASPTNWQAPSTPTWALPSTGYGTASPIPVYTPAPLWRPGGI
DYNLHYWGSF

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_57455-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	133	402	8.4e-48	0.76

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.33e-23	160	406	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	4.34e-17	38	413	48	396	polygalacturonase
227721	Pgu1	6.43e-16	38	334	84	405	Polygalacturonase [Carbohydrate transport and metabolism].
177865	PLN02218	6.54e-16	38	363	69	383	polygalacturonase ADPG
215426	PLN02793	7.63e-14	188	363	187	369	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD67157.1|GH28	0.0	1	490	1	455
ABD67155.1|GH28	1.26e-317	1	490	1	455
CAK96548.1|GH28	2.84e-311	1	490	1	474
QQK39531.1|GH28	1.69e-302	1	490	1	489
QRD82401.1|GH28	1.45e-291	15	490	12	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.36e-87	19	483	1	418	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	1.71e-07	178	365	151	345	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	1.12e-92	15	483	14	436	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	2.15e-92	15	478	15	432	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	1.20e-91	15	478	15	432	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|B0Y0Q3|RHGB_ASPFC	3.58e-91	1	483	1	441	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rhgB PE=3 SV=1
sp|Q4WV23|RHGB_ASPFU	1.98e-90	1	483	1	441	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999767	CS pos: 18-19. Pr: 0.9616

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_57455-t33_1-p1.