CAZyme Information: ASPTUDRAFT_49308-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_49308-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	KV878177|CGC7	63120.21	5.6002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878177:1013023-1014854(+)

Full Sequence      

MASTDQTWEFIVVGGGPAGCALASRLARSARRPQVLLLEAGPRKDDPSLRVDGQRWQTFM
NGDLNWGYKTTPQEHCNGRQIDYSRGKVLGGSSAINFGVYTVGARDDYNQWAGLVGDDLF
RWERMQARFRQLETFNGAIVDPKNSKYATPKTSDHGSQGGLKVGYAAEWEQDLPLMMDVF
EQAGLTRNPDHNSGDPIGMALVINSSHQGRRVTATDLLDGAPSNLTIITETPALKLILQG
TKVVGVETKGAKYFASKEVILTTGSLDTPKILMHSGLGPADQLQQFGIPVVKDIPAVGQG
LRDHFFAPLCFQRNPTTNDRDAFFGNPAAMESALEQWSKDGTGPWARHSCQIGAGWLKSD
RLVASEEFKALPPTVQDFLQRDTVPHYEFMTHFPMHLIAPEPFKDYSYVCMLVFLMNEQS
SGEVRLQSANPEDPLLFDPKFLSHPFDRRACIEIYRHALEVTKHESFQKDTVSALIAPPS
ESDEDILEFWKNTLGSSWHMTGTTKMGKTGDVDAVVDSRFRVFGVENLRIADMGVVPVLT
NNHTQATAYVTGLTCGDALAEGYGLDISEARL

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_49308-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	559	1e-150	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.36e-88	1	561	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.77e-85	3	547	1	519	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.19e-37	419	555	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.62e-30	5	552	53	569	Protein HOTHEAD
366272	GMC_oxred_N	2.33e-22	76	304	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99292.1|AA3_2	0.0	1	572	1	572
BCS11595.1|AA3_2	0.0	1	572	1	572
CAK46531.1|AA3_2	0.0	1	572	1	572
EAA62931.1|AA3_2	1.98e-271	3	572	2	575
UPL00845.1|AA3_2	4.71e-265	1	565	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	3.19e-58	8	563	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	2.92e-54	8	559	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	3.97e-54	8	552	2	554	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6YS1_AAA	5.11e-48	6	546	6	547	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
3Q9T_A	6.92e-48	2	559	1	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ60|ATC_ASPTN	2.12e-63	1	549	39	583	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	5.42e-63	5	570	48	627	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	3.93e-62	5	562	38	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q47944|SDH_GLUOY	2.12e-61	8	557	5	525	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.39e-60	8	546	2	514	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_49308-t33_1-p1.