CAZyme Information: ASPTUDRAFT_49057-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_49057-t33_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		32359.78	4.1668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878177:468188-469138(-)

Full Sequence      

MQVQSNTCISIYDRAPNDTYKQALDNLHDAFNARARDSEGAFWYWNPYPNWGVLEGLFPL
SSFISMWKTYFDPTNTTLTDSLTLSLDLFKDHCHDDSSGLLFHGYDSSKTASWADPTTGA
SPYVWNRALGNWFMTLVDLLERSGKNSAILNETQRDDVYTKYWNVANTIINDADEETGCW
WQVMLHGGEEGNYIESSGSAQFVYGLLKGARLGYLQGETPNGVAYTDAADKCYKYLLSEF
VKEEADGTLGYNGTVADCGLYDPTFEVRIFLPVFFFSAPLDWEREC

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_49057-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	6	264	1.8e-57	0.713855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.89e-29	7	247	87	311	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.46e-28	7	256	80	306	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99486.1|GH105	3.51e-192	12	273	132	393
BCS11787.1|GH105	3.51e-192	12	273	132	393
CAK42095.1|GH105	1.53e-184	12	267	132	387
BAE63195.1|GH105	2.99e-75	12	284	136	412
QRD85043.1|GH105	4.84e-75	12	277	136	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.45e-39	9	260	84	322	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.42e-31	11	247	99	322	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.22e-30	11	247	89	312	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	3.81e-30	11	247	99	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	8.68e-21	96	280	35	210	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	8.68e-21	96	280	35	210	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999789	0.000218

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_49057-t33_1-p1.