CAZyme Information: ASPTUDRAFT_45465-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_45465-t33_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		64061.69	7.2847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878205:1339257-1341314(+)

Full Sequence      

MENSFDYIICGGGTSGCVVAGRLAENPHIRILIIEAGQHNKDLENVHMVGGWGNLLDSST
DWNIVTPPMPNVNNRQVKLSRGKFLGGCSGCNGTLCIRGSKQDYDDWGLDGWSGKEFFKY
MQKAETFHTKPWFKASDQHHGNSGPLHVEPHDLAPISERIMDSFVSQGLPLDPDMFTTGE
TSHGCGHVPRSVYNGIRTTSGDFVTNGYHRNNVTIMTETTVDKILFKKTPSGPKADGVSV
VTANGRRTLHAKREIIISSGSYCSPTILMRSGLGPKEELQKHNIECLVNLPGVGKNLMDH
LIVFMFYETEKPGLTTDHHVYHGDSFDKTYALWKEKKEGFLSTFPFGSFAFARLDERLKN
EPLWKNAPRQPGRDPMGLTPNQPNVELFTTECYGGPKQYDQFPIDHKYAFSIIAELFSPR
SRGSVTLKSKDPLEKPVVDCNYLADPLDLLVLTEACRFANEIITKGAGTKDIVKGSWPPN
LTHHTYTKREQWIPYVKEHATTCYHAGGTCAMGPDGDTNAVLDNKLRVRGVTGLRVADCS
VMPTLNGGHTQMPAYGIGEKCADLIKETWASQALNVAKL

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_45465-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	567	1e-165	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.18e-106	1	566	2	532	choline dehydrogenase; Validated
225186	BetA	5.42e-101	1	567	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.08e-41	419	561	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.06e-32	69	302	11	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.87e-27	2	541	53	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07163.1|AA3_2	0.0	1	579	1	579
CAK49001.1|AA3_2	0.0	1	579	1	566
UDD65288.1|AA3_2	0.0	2	574	6	579
QMW48130.1|AA3_2	0.0	2	574	6	579
QMW36070.1|AA3_2	0.0	2	574	6	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.03e-79	5	566	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.84e-79	5	566	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.98e-79	5	566	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	2.34e-65	2	572	11	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.26e-65	2	572	11	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	2.41e-79	1	566	1	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.25e-78	4	575	6	543	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	6.06e-75	1	565	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	2.32e-74	1	565	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q2T6D0|BETA_BURTA	3.64e-74	5	567	6	534	Oxygen-dependent choline dehydrogenase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_45465-t33_1-p1.