CAZyme Information: ASPTUDRAFT_44737-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_44737-t33_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	KV878204|CGC12	38707.25	5.2197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878204:2565486-2566735(+)

Full Sequence      

MTSKYSKFVRALLIAILMLAMLAISLRHLGASISLQASQLDHLPEKQINWSRFAYTQYAT
DRSYLCNSVMIFEALHRLGSKADLVLMYPSNFLVSENDDSPEAHLLRFARDKYAVKLKPM
EVIYKGGGGETWSRSYTKVLTFNQTEYDRVLHLDSDATLLQTMDELFLLPSAPVAMPLAY
WFHQEDKVFTSALMLIEPSTAEFSRLTDEIWDGVSGGYDMDIVNRLYGDTALIIPHRPYM
LLTGEFRSKDHEAYLGNADEMWDADKALEAAKYLHFSDWPVPKPWITATQHVLEETQPPC
EVQLVTGQQDDCHVRQLWLGMYEEFRSRRQNICGVALS

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_44737-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	42	286	1.5e-22	0.914396887159533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	7.34e-94	53	325	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	1.98e-19	53	285	1	212	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.60e-14	51	210	69	223	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	2.77e-09	54	285	2	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16636.1|GT8	2.63e-239	1	338	3	340
BCS05078.1|GT8	1.68e-232	1	330	3	332
CAK97109.1|GT8	1.54e-170	43	337	45	339
BCS10914.1|GT8	3.61e-169	43	337	45	339
BCR98580.1|GT8	3.61e-169	43	337	45	339

PDB Hits     

ASPTUDRAFT_44737-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBL2|GNT1_ASPFU	1.40e-99	40	333	67	373	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	7.58e-96	48	333	150	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q6FQ15|GNT1_CANGA	4.34e-29	46	329	84	484	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q9Y761|GNT1A_KLULA	1.97e-28	48	285	91	421	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1
sp|Q6CT96|GNT1B_KLULA	6.54e-28	48	335	80	452	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.914568	0.085441

TMHMM  Annotations     

Start	End
9	31