CAZyme Information: ASPTUDRAFT_40874-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_40874-t33_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		48051.51	5.1518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878198:536356-537811(-)

Full Sequence      

MVILSISGLAIFAGLSLATSAVPSLQKNGTTCTVIPLGNGQDDVPNILSAVYQCGQTSGG
RIVLPAPYTYRINQRMTTHLTDSRLEIGGTLLFSDNIDYWVNNSYRVDFQNQSSAWRITG
HDYVVDGGPHQGGVDGNGQLWYTWAKGGSNVFGRPMPVHVFQSTRATLRNLAIRQPQFWA
VLVDSSSHINLDNFYVNATNHDFSVSPEGEWVQNTDGIDTYRSDHITITNWIYQGGDDAV
AFKGNSTNIHVENVTVYGGPGIAFGSLGQYPDRTDIVENVTVRNVQVQPSFQRAMNSGVY
FKSWIGVNYGVPPNGGGGGHGYVRNVTVENLRLKDVQLPVYIDTCLSYLFSENITQYCDT
STYEFNDLHFKNISGNGLATVTDYPGKNISFAVSLLCSEKAPCTDLTFRDINIKLPANYT
GEDVLCENAEVQGLRCNS

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_40874-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	52	431	3.7e-74	0.9723076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.73e-26	132	413	61	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	8.23e-21	38	432	46	393	polygalacturonase/glycoside hydrolase family protein
177865	PLN02218	5.36e-20	6	431	51	420	polygalacturonase ADPG
215426	PLN02793	2.03e-19	54	422	80	400	Probable polygalacturonase
178580	PLN03003	6.82e-19	124	422	116	366	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93142.1|GH28	0.0	1	438	1	438
BCS05796.1|GH28	0.0	1	438	1	438
ABD14403.1|GH28	1.57e-313	9	438	9	438
ABD61566.1|GH28	2.14e-311	9	438	9	438
QRD93508.1|GH28	3.88e-261	4	438	3	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.78e-23	42	438	30	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1RMG_A	3.11e-10	31	433	20	357	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	4.26e-06	155	414	151	375	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2EQQ2|RGXA_ASPNG	2.79e-314	9	438	9	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	3.80e-312	9	438	9	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	6.89e-262	4	438	3	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	6.89e-262	4	438	3	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|A2QG68|RGXB_ASPNC	3.47e-77	11	436	10	415	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000424	0.999555	CS pos: 21-22. Pr: 0.7173

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_40874-t33_1-p1.