CAZyme Information: ASPTUDRAFT_38954-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_38954-t33_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	KV878187|CGC17	50976.00	4.3981

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878187:692663-694268(-)

Full Sequence      

MRSHHLTASLLLLLHSQRAYSDLGIQVNDADSLKNAGSTIADPLMVFYKQNQTEGIPGKL
TDTWYIAGAMFMTLIQFWQASGVDTYNSVVQHDLMFQAGENYDYFSSNYSQWLGNDDQMF
WGLAAITASETGFPEVSGKPSWTSLARAVFNMQVNRWDDTACDGGMRWQIWPYQAGYTMK
NAISNGGLFELSARLARFTKNDTYAEWAEKIFDWSETTPLLNTNATIWNVADSTSNEANC
KDIGNNQWTYNYGTYLSGAAFMYNYTNGSTKWEQRVNNLLTSITTKFFPQDYSNGTVLSE
VTCEPILSCDRNQLGFKGYVAMWLAFTALLVPSTHDIILPKLQGSAAAISKQCSGTGDGL
ENLCGVRWHQDTWDGSMGLEVQMSALGGVTGALMMLGDGSSGPQTIDENPDAAEHHIDTS
EDEKDPTAKEKIETGDRAGAWILTVLLAGLMLGAVGWLVKAQ

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_38954-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	397	2.4e-95	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	32	386	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.010	108	256	82	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96455.1|GH76	0.0	1	462	1	462
BCS08967.1|GH76	0.0	1	462	1	462
CAK37547.1|GH76	0.0	1	458	1	458
QMW48345.1|GH76	9.80e-250	6	462	9	458
QRD92720.1|GH76	9.80e-250	6	462	9	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.77e-84	26	394	29	404	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	1.32e-97	23	395	20	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	8.74e-91	10	459	9	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	3.52e-89	23	459	19	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	3.02e-86	27	458	24	440	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q75DG6|DCW1_ASHGO	3.37e-84	23	459	22	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000652	0.999304	CS pos: 21-22. Pr: 0.9646

TMHMM  Annotations     

Start	End
437	459