CAZyme Information: ASPTUDRAFT_38512-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_38512-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	KV878176|CGC26	50586.85	6.2493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878176:4450185-4451601(-)

Full Sequence      

MTISTRATATEDRSSKPLIVIACATITGHTLPLLPHANELTKQGFDVSFIGGPEFETLIR
KTGATFYPIEHLYSQESLDYLESIPDRSARIIWGLKRFFIDLTASRMKSLQTVLETLREK
HPNREVVLIQELGYMGTWPYLLGAPPPKGYKQFPKTLTFTTTPLLVTSVDTAPFGSGLAP
DSSDDGRTRNAAMYAAEKVIRDELVDHSNSVYASLGATMKVDQWLFDLWSTHTILLQPCS
PSLEYPRSDLSPKVRFIGGTPCRKTDLSTPLPEWWGELETNRHAANPKKVVFVTQGTVKT
YYKNLLIPAIQAFADRPDVMVIGVLGVKGAVLGEDHKIPDNAKVIDYLSYDAVLPYVDVF
VTNGGYGSFMHGVMNGVPMVLAGTVQDKGEVCMRGEWAGVGINLRTDTPSPETIRENVER
ILSDPKYKARSVVIQRENEELDSVSSLRRYILENE

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_38512-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	56	451	2.6e-32	0.9083769633507853

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	1.72e-36	19	453	5	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	9.50e-31	19	453	3	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	6.96e-25	28	440	7	375	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	1.60e-10	243	428	237	412	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	0.004	334	430	340	438	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13313.1|GT1	1.52e-315	1	455	1	455
BCS01597.1|GT1	1.52e-315	1	455	1	455
CAK39187.1|GT1	1.63e-285	1	455	1	456
UPK94024.1|GT1	3.62e-119	14	452	23	459
UQC81531.1|GT1	4.12e-119	11	453	115	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	3.16e-12	282	437	222	376	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	3.20e-12	282	437	225	379	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6PNT_A	1.98e-10	251	443	239	420	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
2YJN_A	6.23e-10	337	429	316	408	Structure of the glycosyltransferase EryCIII from the erythromycin biosynthetic pathway, in complex with its activating partner, EryCII [Saccharopolyspora erythraea NRRL 2338]
3WAD_A	2.43e-09	310	445	270	403	Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAD_B Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAG_A Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii],3WAG_B Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	1.68e-104	12	452	15	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	2.17e-71	14	453	5	433	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	2.06e-70	16	453	5	429	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	2.24e-54	19	444	5	410	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|A4F7P3|ERYC3_SACEN	3.04e-09	337	429	296	388	3-alpha-mycarosylerythronolide B desosaminyl transferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=eryCIII PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000011

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_38512-t33_1-p1.