CAZyme Information: ASPTUDRAFT_37986-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_37986-t33_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	KV878176|CGC33	52020.43	9.8058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878176:3253030-3254531(-)

Full Sequence      

MSWLTRSSFRHPYRSLFSVFLLWKASLLLLAILTPGPGYDTSTTLFPWHKNTNQTEKIIP
STLRRISIKLTRWDSIYFTEAARRGHLLEQEWAFSYAFSRFINLLASGFTNIGAIPYEFK
HSALGTAISHAAHAISLVVLYRLACTLFPGAQGRKLAFIAACLHIISPAGLFLSAPCTES
TYSLLSFTGTLLFAQSFGARGVSTSIKDSLLVLTGILYGLSTAVRGNGLLNGIVLFEEAC
RILYSLTQGFSYAKFRRLVAVGLGGICTGLGFVLPQYIAYQHFCATHEDPSREWCHRTIP
SIYSFVQDHYWDNGFLRYWTLSNVPLFALASPMLVILVYSAIWTLGVDSRRRETPTNTMQ
PGSPTGQLTGRLMRSLAAPQITLAVMVFFCNHVQIITRLASGYPVWYIWTATLIMNRYTG
PSTASKRQLEEKTNDRNSYWQIIVQYMVIYAAVQGVLFAAFLPPA

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_37986-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	19	465	5.5e-113	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.89e-41	70	465	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.10e-14	72	465	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97098.1|GT76	4.93e-317	1	465	1	464
BCS09572.1|GT76	4.93e-317	1	465	1	464
QMW44188.1|GT76	1.80e-175	13	465	9	472
QRD83592.1|GT76	5.90e-174	13	465	9	472
QMW32162.1|GT76	5.90e-174	13	465	9	472

PDB Hits     

ASPTUDRAFT_37986-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	2.04e-101	11	465	17	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.15e-97	12	465	10	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	6.13e-93	10	465	27	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	7.38e-93	11	465	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.50e-53	13	465	4	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987985	0.012051

TMHMM  Annotations     

Start	End
13	35
93	115
122	141
156	175
182	199
214	236
257	279
325	347
442	464