CAZyme Information: ASPTUDRAFT_31578-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_31578-t33_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257		30222.16	4.5856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878205:293582-294417(-)

Full Sequence      

MVYGNKTSYYRGLKTHEDHAQKFGYPMTVLRKPILGGYWSKPAILLSTIIEEMQKPEEQR
VQWIFWVDGDTAVMNPNIPLEIFLPPERYADTHLLMAKDWNGINNGVFFMRVNQWAVELL
SATLSYPVVHPEISLFWADQSAMENVINENDYFSRSIAFCPLRWFNAYPRNADAIDLNPD
RPVEFQLHHGDFLVHFPGAPKDRFDEIMDPYLTIAESHSPDWELPFDKTSYYKEIADYWQ
DKYAELFGQKLEFESEY

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_31578-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	11	201	8.1e-32	0.8658536585365854

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	8.22e-18	18	198	35	231	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.46e-09	5	122	155	264	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	6.57e-08	11	132	152	275	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96623.1|GT34	2.02e-127	1	252	1	240
QKX62037.1|GT34	2.87e-98	1	240	307	548
BCS22997.1|GT34	4.05e-97	1	241	69	308
BCS22806.1|GT34	1.33e-93	1	251	121	370
QKX54237.1|GT34	6.96e-90	1	239	44	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	2.75e-08	19	220	70	250	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	1.91e-12	13	226	150	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|Q564G7|GMGT1_CYATE	4.90e-09	11	132	142	265	Galactomannan galactosyltransferase 1 OS=Cyamopsis tetragonoloba OX=3832 GN=GMGT1 PE=1 SV=1
sp|O94622|YBKD_SCHPO	5.94e-09	13	228	128	364	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q6Z5M3|GT7_ORYSJ	6.69e-09	11	151	144	288	Probable glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=GT7 PE=2 SV=1
sp|A2X933|GT7_ORYSI	6.69e-09	11	151	144	288	Probable glycosyltransferase 7 OS=Oryza sativa subsp. indica OX=39946 GN=GT7 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_31578-t33_1-p1.