CAZyme Information: ASPTUDRAFT_27556-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_27556-t33_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1014		111394.27	4.5780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878187:1729792-1733117(-)

Full Sequence      

MTRITKLCALLLSSTGLLAAAQNQTETGWPLYDDGLTTDIQWDHYSFKVHGERIFVFSGE
FHYWRIPVPGLWRDILEKIKAAGFTTFSIYSSWAWHAPNNHTVDFSTGARDITPIFELAK
ELGMYIIVRPGPYINAEASAGGFPLWLTTGDYGTLRNNDSRYTEAWKPYFEKMTEITSRY
QVTNGQNTFCYQIENEYGDQWLSDPSERVPNETAIAYMELLESSARENGILVPFTANDPN
MNAMAWSRDWSNAGGNVDVVGLDSYPSCWTCDVSQCTSTNGEYVAYQVVEYYDYFLDFSP
TMPSFMPEFQGGSYNPWAGPEGGCGDDTGVDFVNLFYRWNIAQRVTAMSLYMLYGGTNWG
AIAAPVTATSYDYSSPISEDRSISSKYYETKLLSLFTRSARDLTMTDLIGNGTQYTNNTA
VKAYELRNPTTNAGFYVTLHEDSTVGTNEAFSLRVNTSAGNLIVPRLGGSIRLDGHQSKI
IVTDFTFGSETLLYSTAEVLTYAVLDKKPTLVLWVPTGESGEFAVKGAKSGSVVSKCQGC
SAINFHQQGGNLVVGFTQAQGMSVVQIDNDIRVILLDRTAAYEFWAPALTEDPLVPEDEA
VLIQGPYLVRSASLEKSTLAIKGDSINETAVEIFAPKDVKTVTWNGKQLKTSKSSYGSLK
ATIAAPVSIQLPAFTSWKVNDSLPERLPTYDASGPAWVDANHMTTANPSKPATLPVLYAD
EYGFHNGVRLWRGYFNGTASGVFLNVQGGSAFGFSAYLNGHFLGSYLGNASIEQANQTFV
FPTNITHQATQNTLLIIHDDTGHDETTGALNPRGILEARLLPSSTDNTTSPEFTHWRLAG
TAGGESNLDPVRGAWNEDGLYAERVGWHLPGFDDSTWPSVSSSSLSFTGATVKFFRTTIP
LNIPRGLDVSISFVLGTPNNAPNAYRAQLFVNGYQYGRFNPYIGNQVVFPVPVGVLDYSG
ENTIGVAVWAQTEDGAEITVDWKVNYVADSSLDVAGLETSGLRPGWSVERLKFA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	48	393	6.1e-82	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402180	BetaGal_dom2	4.42e-82	403	582	1	179	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
396048	Glyco_hydro_35	4.50e-80	46	393	1	314	Glycosyl hydrolases family 35.
198097	BetaGal_dom2	1.69e-65	402	584	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	5.44e-38	861	974	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	9.41e-32	690	804	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96126.1|CBM67|GH35	0.0	1	1014	1	1015
AOV94179.1|GH35	0.0	1	1014	1	1014
CAK37216.1|GH35	0.0	1	1014	1	1014
BCS26099.1|GH35	0.0	1	1014	1	1036
AGS42423.1|GH35	0.0	22	1014	1	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	2.28e-187	40	978	6	938	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	1.27e-171	25	978	31	974	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	3.53e-171	25	978	31	974	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
3OG2_A	7.14e-167	40	978	26	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	1.48e-166	30	978	36	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6QLF0|BGALB_TALMQ	0.0	29	1014	24	1009	Probable beta-galactosidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacB PE=3 SV=1
sp|B0XNY2|BGALB_ASPFC	0.0	1	1014	1	1015	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1
sp|B2W791|BGALB_PYRTR	0.0	4	1014	10	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1
sp|B6GW04|BGALB_PENRW	0.0	1	1014	1	1013	Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacB PE=3 SV=2
sp|Q2U6P1|BGALB_ASPOR	0.0	5	1014	6	1022	Probable beta-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000554	0.999406	CS pos: 21-22. Pr: 0.7247

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_27556-t33_1-p1.