CAZyme Information: ASPTUDRAFT_200738-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_200738-t33_1-p1
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	KV878198|CGC4	43349.99	4.8670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878198:3052892-3054163(-)

Full Sequence      

MLLHGLVLALQAILASSAAITSPSSNHLSTAAREKCQTTLQCPPGTIVVSNTNTHSDISN
FTTLQAAINALPNDNSSQTILLLSGSYNEQVNITRSGPITLLGQQPDRAALTDPARNTVN
LTFAGANSDSSGNIDNVWFSVMVVAPTLDASLTGSGTTGYPVPADTPFGNTNFRVYNIDF
RNTYAPYSAGPAHAISFSRSNGGFYYCGFYSYQDTIYIGKLGSAYMYKSILAGQTDFLYG
FGTLFIQSSQIILRSCGGGITAWKGTNTTVRNNYGVYIHDSTINAANSSIAEQIQGSCAL
GRPWNSLHRSIFANTYEDGSIEPSGYINWEDRWSKNETLMAEYRAYGPGFNLTGREESEV
SVLLSSSEEERYRDPKRVFLFEDGREGNVAWIDWDVVSS

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_200738-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	57	372	4.3e-58	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	1.53e-26	60	355	16	275	pectinesterase
215535	PLN02990	8.73e-25	55	355	265	531	Probable pectinesterase/pectinesterase inhibitor
215367	PLN02682	2.26e-23	43	355	67	340	pectinesterase family protein
178051	PLN02432	3.10e-23	60	355	22	265	putative pectinesterase
395871	Pectinesterase	5.47e-22	60	355	11	271	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06612.1|CE8	7.36e-290	1	399	1	399
BCR94001.1|CE8	7.36e-290	1	399	1	399
CAK44519.1|CE8	9.54e-281	1	399	1	397
BAE63594.1|CE8	1.39e-166	5	396	5	385
UDD62592.1|CE8	1.39e-166	5	396	5	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.23e-21	43	367	7	284	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.05e-21	43	367	7	284	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.69e-08	207	355	125	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.39e-08	56	349	13	310	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	1.87e-06	56	349	13	310	Chain A, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK82|PMEA_ASPNC	1.95e-21	10	367	7	312	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q9ZQA3|PME15_ARATH	3.46e-19	60	349	100	352	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
sp|O22256|PME20_ARATH	1.22e-18	60	355	255	518	Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana OX=3702 GN=PME20 PE=2 SV=2
sp|Q8RXK7|PME41_ARATH	3.02e-18	46	355	252	531	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2
sp|Q9LVQ0|PME31_ARATH	2.50e-17	61	349	17	269	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999757	CS pos: 18-19. Pr: 0.9662

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_200738-t33_1-p1.