CAZyme Information: ASPTUDRAFT_195739-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_195739-t33_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		92442.92	5.7169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878178:931603-934316(+)

Full Sequence      

MSCVHAAAETDKSFVQIANADIEELIKQLTLDEKVSLLTGDDFWHTVPIPRLGIPSIRLS
DGPNGVRGTRFFGSVPAACLPCGTAIGATFDKDLAVQVGHLLAAEAKAKGAHVVLGPTIN
IQRGPLGGRGFESFSEDPLLSGIIAGHYCKGLKEKNIVATLKHFVCNDQEHERMAVNSIL
TDRALREIYLLPFMIAISLGRPEAIMTAYNKVNGLHASESPTLLQDILREEWGWEGLLMS
DWFGTYSTSEAINAGLDLEMPGPTRWRGSALSHAITANKIRMATVNARVRAVLRLVQQAS
RSGIPEHAPELQLNRAEDRRLLRKIASEAVVLLKNDDSILPLDKTKKIAIIGPNSKIATY
CGGGSAALNPYQAVTPFEGISNSTSGGVEFAQGIYGHQNQPLLGKRLRTQDGRTGFTLKI
FNDPPTVANRVPLEERHETDSMVFFLDYNHPELQPVWFADAEGYFVPEESGLYDFGLCVQ
GTGKLYVDGKLLVNNADVQRPGSSFLGSGTMEERGTLELTAGRQYKIHVQWGCAKTSTFK
VPGVVDFGHGGFRFGACKQLSPSTGIEEAVQLAASVDQVILVAGLSAEWESEGEDRTSMS
LPPHTDELISRVLEVNPDTVVVLQSGTPVEMPWIQKAKAVLHAWYGGNETGNGLADVIFG
DVNPSGKLPLTFPRHVKHNPTYFNYRSEGGRVLYGEDVYVGYRFYDEAEIDPLFPFGHGL
SYTTFELSGLSLEREACSLQATCTVRNTGSRAGAEVIQLYVSPVSPPIKRPLKELKGFRK
VWLEAGAEEVVQIPLDLIRATSFWDEKSSSWCSHSGTYQIMLGTSSRGTFLEDSIELSET
TFWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	49	261	1.4e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.60e-97	19	827	35	755	beta-glucosidase BglX.
224389	BglX	5.85e-75	42	383	48	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.82e-60	330	722	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.74e-49	25	832	56	778	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.34e-41	47	295	59	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12335.1|GH3	0.0	1	846	1	846
BCS00565.1|GH3	0.0	1	846	1	846
CAK49185.1|GH3	0.0	1	846	1	846
QMW48789.1|GH3	0.0	14	845	15	847
UDD66060.1|GH3	0.0	14	845	15	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.43e-261	21	846	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.73e-256	21	846	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.56e-155	21	840	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.46e-118	26	827	9	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.06e-113	24	826	56	817	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	21	846	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	22	846	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	0.0	21	846	5	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q0CAF5|BGLI_ASPTN	0.0	21	846	5	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	0.0	22	846	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000009

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_195739-t33_1-p1.