CAZyme Information: ASPTUDRAFT_195735-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_195735-t33_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		45990.52	4.1407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878178:921602-923028(+)

Full Sequence      

MLSKMQLAQLAAFAMTLATSEAAYQGFNYGNKFSDESSKFQADFEAEFKAAKNLKTTSGF
TSARLYTMIQAYSTSDVIEAIPAAIAQDTSLLLGLWASGGGMDNEITALKTAISQYGEEL
GKLVVGISVGSEDLYRNSVEGVEADAGVGVNPDELVSYIKEVRSVISGTALADVSIGHVD
TWDSWTNSSNSAVVEAVDWLGFDGYPFFQSSMANSIDNAKSLFEESVEKTKAVAGDKEVW
ITETGWPVSGDSEGDAVANIANAKKFWDEVGCPLFGNVNTWWYILQDASPTTPNPSFGIV
GSELSTTPLFDLSCKNSTTSSSSAVVSAAASSAASSKAVGSSSGAQASATPSFTVGRPGV
NGTVFGNGTYPLRPSGSASARPSAGAISSGSGSGSSGSGSSGSTGTSATSGQSSTSGSAA
AGSSSPAAFSGASTLSGSVFGAVVAVFMTLAAL

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_195735-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	7.32e-30	26	276	47	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.43e-10	26	314	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12328.1|GH17	2.51e-274	1	453	1	453
BCS00559.1|GH17	2.51e-274	1	453	1	453
CAK49181.1|GH17	4.72e-247	1	390	1	400
EAL86311.1|GH17	7.75e-170	5	378	1	381
QMW36860.1|GH17	1.02e-168	4	390	6	391

PDB Hits     

ASPTUDRAFT_195735-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	1.97e-245	5	390	1	396	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q4WG16|EGLC_ASPFU	1.38e-170	5	378	1	381	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.58e-170	5	378	1	379	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	8.12e-169	5	390	1	385	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.96e-166	5	384	1	388	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000444	0.999533	CS pos: 22-23. Pr: 0.9456

TMHMM  Annotations     

There is no transmembrane helices in ASPTUDRAFT_195735-t33_1-p1.