CAZyme Information: ASPTUDRAFT_190980-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_190980-t33_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1381	KV878203|CGC11	150705.31	4.6428

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878203:3194979-3199734(+)

Full Sequence      

MLRPLVGVLCLFFLLGWLPGISASQHGHHTHHHLYRRHNGTESAESDGSPKHIVEEALKA
LRIANKLRVENSQFNKWEFQDDTSQDKGLTDVPLSDYSDSTKNVSLAQLNRRSSINDSSS
LESNPKYGYTLSPAIVKAAKEVAESEKPTPWDIDYASIASEIRAKWSAGTNDTNAMVQKL
SRSNGLDQYTSFGQPDGLQEPTEEGVSKRDTSSYWMASVEKNGASPYAAFGYKVWRNVMD
YGAKGDGVTDDTAAINRAISDGNRCGADCKSSTRYPAVVWFPSGTYLVSSPVIQYYNTQL
LGDPTNLPTILAASSFVGLGVITSDVYVGDSEEWYLNTNNFLRSIRNFKMDITRTDQSAY
VCAIHWQVAQGTSLENIEFYMLQNVEGNTQQGIYMENGSGGFLADLTFVGGNFGAYFGNQ
QFTTSHLVFVNCKTALQVHWDWAWTMQDVVIESCGTGILLTGGAGGAASTGQSLGSFILV
DAIIANTPTGIVTSLLAENSTSLLLQNVGFFNVQNSVTDSVLSKVLLAGGNEVPVDNWGF
GRVTNANGESSFINGANISPMNRTDSLLSTELAYVKPNFYTRRRPKYVNIRQSQIINLKT
AGAKGDGVTDDTTALNSIFAAAANMSSIVYVPYGVYIVTNTVKIPVGSRIIGQAWPQIMG
KGKNFQDQLHARPVVQVGEVDESGVVEIQDMMFTVSGATAGAILVQWNVHEITRGSAGLW
DSHFRVGGAVGSELQGDKCPKGGGINTDCIGASALLHVTSKASAYIENSWAWVADHDLDA
ADEAQIDIFSGRGILIESQGPTWLYGTASEHNVLYQYQFSNSKNVIAGMIQTESPYFQSH
PGAPLPIVTGGFPNDPHFDNCTISSPATCAVSWAVRIVDSSSVYILGAGLYSWFSRYSQD
CLATENCQDRAFEIEESQELWIYNLVTKAIVEMISPVNEKPTLANDNKNGFMSSILAWLK
GSTDTTGQRVFEGFTIYDTNMLPSTFSDACITALTATIKCDLQVFQFGEPQYHGTLGNDT
LTDLVCDQSCGDSLARWFTNAEANCNGAVLLDHPATILGGNMWEGWNETCYKDPTTGKYC
NGQFTRVASVDLMPKDEMCSYCYKTKLQMMQSSPYSYYNQRYKYNLETVIKNCGVTSNTT
IPDDLSVTQPEDEPFCPDDSSYTTKDGDTCTSIALDYSVASAALYMGNQDQIRDCNQVVV
GQELCLPLPCDHTYVLKSNDTCRSIEEANAAIMFDNSTKRIIPLRQVNPWIDTYCSNLQS
TSWAYGKVLCLTPQSGLFNATDPVSTSYNPWGTESSGYGSWVVLPPDNATVAAGTTKHCG
KWHTATTEDTCTQICVQDRITSNLFLQVNPSLQSANCTGLLIPGNAYCTGPMRGWNYTVA
T

Enzyme Prediction     

EC	3.2.1.58:16	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	206	958	5.7e-276	0.9905405405405405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	2.75e-93	235	458	1	212	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	2.26e-10	595	654	1	62	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	5.06e-04	237	287	84	125	Polygalacturonase [Carbohydrate transport and metabolism].
396179	LysM	6.22e-04	1162	1207	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
212030	LysM	7.92e-04	1161	1206	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66649.1|CBM50|GH55	0.0	29	1376	44	1371
EAA67102.1|GH55	0.0	8	1379	13	1372
BCS21778.1|CBM50|GH55	0.0	43	1375	56	1362
CZS83162.1|GH55	0.0	39	1375	42	1351
UQC82111.1|CBM50|GH55	0.0	47	1376	46	1365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.90e-207	212	962	4	756	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.89e-195	214	960	26	757	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	3.11e-07	237	433	76	288	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	3.68e-208	195	962	24	877	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	6.78e-162	186	955	26	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.02e-52	202	908	26	705	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999775	CS pos: 23-24. Pr: 0.9757

TMHMM  Annotations     

Start	End
5	27