CAZyme Information: ASPTUDRAFT_187193-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_187193-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	KV878176|CGC18	39424.03	6.7422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878176:4300981-4302184(+)

Full Sequence      

MKRLLYLLVVLLLSYVVRALPYDDHGKKRDLGPLVDLPGGDVIVWVDQAGNALANNVVGG
GNSNPTATAVNSPATLPPLLPTLDDDLDLSPAVSLPESTKHPKTGNYRRFGISYSPYNND
GSCKTQDQVNQDLDKLAQYGFVRIYGVDCDQTNKVAKAARQRNLKVFAGVFDLQNFPSSL
DYITGAANGDWSVFHTINIGNELVNDGKNSITDVTNAVNTARNKLRAAGYQGPVVTVDTF
SVLIQHPELCQASDYCAANCHAFFDNNNTADKAGQYVKDQANKVSKAARGKKTLISESGW
PHNGQPNGKAVPSSQNQQKAIASLQQTFTGDNELVLFTAFDDLWKQDSPGTFGAEKFWGI
NQR

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_187193-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	111	360	2.1e-23	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.61e-67	111	360	47	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13276.1|GH17	1.16e-261	1	363	1	363
BCS01560.1|GH17	1.16e-261	1	363	1	363
CAK47997.1|GH17	4.08e-246	1	362	1	362
ACQ00076.1|GH17	1.86e-132	38	360	19	361
QMW24913.1|GH17	4.07e-127	1	363	1	326

PDB Hits     

ASPTUDRAFT_187193-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	2.10e-69	111	360	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	8.79e-68	111	360	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	4.26e-64	111	360	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	1.84e-45	91	359	284	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.90e-42	109	359	308	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999788	CS pos: 19-20. Pr: 0.9823

TMHMM  Annotations     

Start	End
5	22