CAZyme Information: ASPTUDRAFT_187117-t33_1-p1

Basic Information

• Species: Aspergillus tubingensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus tubingensis
• CAZyme ID: ASPTUDRAFT_187117-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		40992.32	8.0161

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AtubingensisCBS134.48	12592	767770	274	12318

• Gene Location: location=KV878176:4061664-4062755(-)

Full Sequence      

MTPRTTLKTIRNHIQHQAARCRASLPDISLAPRLQIIVTKARQGPFIFCLSFYLLSTCLS
WLISTLRFSSQLHAHTLSSDILYAYEAPPSAITTKPYHWAPPPSSPLNITSPSSIPPIIH
RIWRGDLTKPIPEEYINASSSCHNQNPTYEQYIWTDTTARQFIEAYFPWFAPIYNDHLLP
MQRVDVLRYFLLWHYGGVYLDPEIGCQWPLDSLLKGAEQEGKVLLSEHWPYGVGNEFIAS
KPNHPFVIKVALSMHEHRWESVPAYAMAFVSAGAVLVSRVLGMWLSTVGGGVGIVPGDMF
EGTEEAFFMRFVGERPRGDEVAVLEWFFGNWVGWCAAGIALGVMGLVVFGVRRQPRKRGY
TLV

Enzyme Prediction     

No EC number prediction in ASPTUDRAFT_187117-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	138	215	4.8e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.49e-28	88	251	55	211	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.26e-16	132	214	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.005	185	256	115	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS01481.1|GT32	1.01e-248	1	363	1	362
BCS13196.1|GT32	1.01e-248	1	363	1	362
UCK58225.1|GT32	8.44e-63	108	363	64	321
QRD88228.1|GT32	1.65e-62	108	363	88	345
BAE56144.1|GT32	1.65e-62	108	363	88	345

PDB Hits     

ASPTUDRAFT_187117-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	4.09e-34	115	359	64	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.62e-30	113	358	55	297	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	7.67e-28	112	280	59	219	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.26e-27	108	278	75	237	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.09e-26	112	325	52	260	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999963	0.000028

TMHMM  Annotations     

Start	End
329	351
44	66